SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VW66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VW66
Domain Number 1 Region: 6-116
Classification Level Classification E-value
Superfamily Histone-fold 7.86e-28
Family TBP-associated factors, TAFs 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0VW66
Sequence length 127
Comment (tr|E0VW66|E0VW66_PEDHC) DNA polymerase epsilon subunit, putative {ECO:0000313|EMBL:EEB17622.1, ECO:0000313|VectorBase:PHUM474950-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM474950 OC=Pediculidae; Pediculus.
Sequence
MAEKLEDLNLPAAVVTRIIKEALPEGCNVAKEAKLALSRAASVFVLYLTSHANKISIGNG
KKIITNEDVMEAIQDTEFGRFEKQLNEAAEHFRKIQNSKKEALNQKKRLKEANQEEGQEN
MQMSLEY
Download sequence
Identical sequences E0VW66
vb|PHUM474950-PA|EEB17622.1|DNA 121224.XP_002430360 XP_002430360.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]