SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VZ11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VZ11
Domain Number 1 Region: 45-124
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0VZ11
Sequence length 126
Comment (tr|E0VZ11|E0VZ11_PEDHC) Heterogeneous nuclear ribonucleoprotein,putative {ECO:0000313|VectorBase:PHUM522830-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM522830 OC=Pediculidae; Pediculus.
Sequence
MRQIGAANPLAGLAALGLPALNTTNTGGLNPAALAALAGSQLRTNNPSRNQQGNSQQTHE
MTVPNELIGCIIGKGGTKIAEIRQLSGAMIRISNSEEREGGNTDRTITIAGNPEAVALAQ
YLINMR
Download sequence
Identical sequences E0VZ11
121224.XP_002431355 XP_002431355.1.24195 vb|PHUM522830-PA|EEB18617.1|heterogeneous

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]