SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0W037 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E0W037
Domain Number - Region: 7-88
Classification Level Classification E-value
Superfamily Prefoldin 0.000759
Family Prefoldin 0.0068
Further Details:      
 
Domain Number - Region: 156-227
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0523
Family Mitotic arrest deficient-like 1, Mad1 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E0W037
Sequence length 233
Comment (tr|E0W037|E0W037_PEDHC) Tropomyosin, putative {ECO:0000313|EMBL:EEB18993.1, ECO:0000313|VectorBase:PHUM544560-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM544560 OC=Pediculidae; Pediculus.
Sequence
MEKLSSLLIDRQSKIENLEKKIFQLEDETEKLENTSKELDVIRNNSKELEEQIKNLKKNV
DNFEKVHENLMSQTSNNETEFKKLREKNKLMEIENDKLKMSSANDKDSLLIKNKIIEDQQ
ETIKQLKEKCEKIKSVTTKNQSLERIIDLERAEKLELQDALEELKWKKDELKKKVKILEN
ELMATPRDVVQDLQKTQVVLHQLENQVQTKQKEWEEHLQSLQKEKEQAYYISK
Download sequence
Identical sequences E0W037
vb|PHUM544560-PA|EEB18993.1|Tropomyosin XP_002431731.1.24195 121224.XP_002431731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]