SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0W0C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0W0C9
Domain Number 1 Region: 151-248
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.26e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00021
Further Details:      
 
Domain Number 2 Region: 262-337
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.16e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00063
Further Details:      
 
Domain Number 3 Region: 36-114
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00025
Further Details:      
 
Domain Number 4 Region: 381-453
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000584
Family Eukaryotic type KH-domain (KH-domain type I) 0.00053
Further Details:      
 
Weak hits

Sequence:  E0W0C9
Domain Number - Region: 479-570
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.085
Family Haloperoxidase (bromoperoxidase) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0W0C9
Sequence length 708
Comment (tr|E0W0C9|E0W0C9_PEDHC) Far upstream fuse binding protein, putative {ECO:0000313|EMBL:EEB19085.1, ECO:0000313|VectorBase:PHUM550050-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM550050 OC=Pediculidae; Pediculus.
Sequence
MSEFASTGGQTNVPQSTAYAAAVQRARESRPASSAGTGFSNEGVFSEEIMVPDKIVGLII
GRGGEQITRLQFESGCKIQMERSRGTVERQCTLTGTREAINRAREMVMNIVSTLIRNENF
GSGGSGNNNNNGNDSFSHPPFHQNQNSVPQGQAFAEIMIPGPKVGLVIGKGGETIKHLQD
TTGARMVVVQDSNSQDYEKPLRITGTQQQVDHAKDLVYQMIADKDVGSGDRRNRADRSHF
NSAGPPSGPNNFSNEFDNNSQPGGGVIEILVPRAAVGVVIGKGGEMIKKIQSSTGAKLQF
EQGRDDGPGDRKCILTGKPEQCEDAREKVIELIDSVQRRDDRREPGRTGRNDRNDRDRRG
QSAGDFDRQAGRNERWNSRDRSERNEITFAVPANRAGFVIGKGGEKIKQINAQCGAYCEI
DRKLSSVNPAEKVFVIRGTPEQIEEAKRLIIEYSGIEDYYGVGSGGGGNSGGNGNNNSHH
QLPITSTAYPNQGGFQPQGWGGPNSNSYQWGGVVQSAGAESNQSQVPINPVNGQPDYTLQ
WVEYYRSIGMVREAEMIEQQAKSNKMMGNANPAQPGSNTQNMNATAPAQQAAGNPQANGA
QPDYSAQWAEYYRSIGKVKEAEAIEAQIKAKAAGGMATVNPQAPSQPSQQQPGQMMATAA
QQPAQFNQFSGFQQQGNPAPYYGAPGQGPPYGNYPGYPGGYGQGGSEN
Download sequence
Identical sequences E0W0C9
121224.XP_002431823 XP_002431823.1.24195 vb|PHUM550050-PA|EEB19085.1|far

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]