SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0W2F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0W2F2
Domain Number 1 Region: 32-222
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-76
Family Sec7 domain 0.000000062
Further Details:      
 
Domain Number 2 Region: 229-350
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-31
Family Pleckstrin-homology domain (PH domain) 0.00000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E0W2F2
Sequence length 371
Comment (tr|E0W2F2|E0W2F2_PEDHC) Cytohesin-1, putative {ECO:0000313|EMBL:EEB19808.1, ECO:0000313|VectorBase:PHUM591140-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM591140 OC=Pediculidae; Pediculus.
Sequence
MANLKQLKDELQEVVAEMENMDTPDESKNYTKTKQLSIGRKKFNMDPKKGIEYLQEHGLL
QATPEDVAAYLYKGEGLNKTAIGDYLGEKNPFNEKVLKAFVELHDFTDLILVQALRQFLW
SFRLPGEAQKIDRMMECFAQRYCQLNPNIFTNPDTCYVLSFAVIMLNTSLHNPSVKDKPS
AEQFISMNRGINNGGDLNKELLISLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQ
GGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENIQVREASDRHKPHCFELYATGT
DFIKACKTDSEGKVVEGKHTVYRMSAATADEKEDWIKCVRQSISHNPFYDMLAVRKKKAQ
KTAVHHHLTNS
Download sequence
Identical sequences E0W2F2
vb|PHUM591140-PA|EEB19808.1|Cytohesin-1 XP_002432546.1.24195 121224.XP_002432546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]