SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0W3Q9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0W3Q9
Domain Number 1 Region: 288-485
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-44
Family cAMP-binding domain 0.00042
Further Details:      
 
Domain Number 2 Region: 46-286
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.73e-36
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0W3Q9
Sequence length 1908
Comment (tr|E0W3Q9|E0W3Q9_PEDHC) Thyroid receptor-interacting protein, putative {ECO:0000313|EMBL:EEB20265.1, ECO:0000313|VectorBase:PHUM608060-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM608060 OC=Pediculidae; Pediculus.
Sequence
MKLRTTETVDTGDDTETANGGPQSHHEVSRRRRKRRKELSKTVVNPDENFYFYWLMTVTV
CVLYNMWTLIVRQSFPELQKAASVFWYVGDGFTDVVFICDIMVQFRTGYLEQGLMVYDSK
KLASHYLKSRAFIFDMLSLLPLDFLQLNVGVNPILRFPRFMKIYRIYNYYYMVESRTVYP
NLWRVVNLIHILLILAHWFGCFYYLLSEAEGFQGDWVYPYRPGDYATLTRKYLGSLYWST
LTLTTIGDLPTPETNAEYLFTIISYLIGVFIFATIVGQVGNVITNRNANRLEFERLLDGA
KTYMRHHKVPGGMKRRVLRWYDYSWSRGRIQGGGDINTALGLLPDKLKTELALHVNLSVL
KKVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILDVISETGRVL
TTMKAGDFFGEIGILNLDGLNKRTADVRSVGYSELFSLSREDVLTAMKDYPEAQEILQNL
GRKRLMEAKNASKMHKTMIKQINCHDSSGDSDTTGKRIVEKLRSDVKGLKNVLRRSRRGG
TRTREDSNENNQLNSGKKQSVLRRMSHVQSSDEFEENNEGSQQPIGAGLPLLQRIKRLKE
KQDREKEKEEREKLKSSNNNVNESDTEVIGAGLPLTQRLKLLKQKEERELAKIKDSSSTV
RTQLTGMKLEKSSSEKTSNATTSDISNPSSKPKEDSTNNNNNSSGSSSCSSSNNNKESSE
GKKTSLIEKLKITVKDNKHLILKTNNNNNNNNNNNNNDSETHLNSNIASHETSEIVPEII
ETDKIVPKLLGSKFEVPKIKNRWELLKKSSLTSSKCGKKYGTGGKNMVRKVVKKGTYLSK
SDTVLEKQKTFDSDEYTQSENDESPNNENNNNLNILNNEETVKRVECDPETENDQRLNIN
NNTNNYQSSNESDNIKKYNSISDLSPEYSGLPFVKKLKILNERQKLAELEKELIVRSASL
DVPDHHHHHHLNSQKEKGILTRSQSEAITVGHLYDRSATTTTTTTTLYRKTSDFNKCTNQ
DSILSLENDVDLEKDTKISDLTETKNSIESIMSPESNETLERRHLKSILKKLSHEGTSSD
EDKERTDFKKRENFDFRKLLRDPTIEGYAARHKKLTKSVTFDNDTLLTSTESLAQENTEK
ESKSFSQLSPTGILTLQLSNLSMIPIVGSNVKKNLIPDNLEEKNILTDEEVEMETIISNI
LDKLQEKLLEKIKILEMGKDGGMNLYPIEENEGKASNFLSCKNNQGGDGELLPDIISGVQ
QIMRNVLVEIQNKFQFRFNKLEIEVEKRDEIICQLKTQIKELEKEESHNSYCDQKSMKNF
PSTVNDKDNLRSISNSLDEKSKNIITGNKGMIIQNLTENDSTTESVTFNGEDFKTHLLSK
SDCNKSSKIYNLNQSKNITAESGGQFELHNLSKFMKIYEMKQRKRYNREVKIKKNLSEDE
THQMSQHSPKPQRRWSSSSKPREEKFKLKDRLKEKSFGRTSGFQRSFSCSQDADFVALNM
DDDSGSSDVEQPNNKNWEIEMLVQEWEKLESSKRVFDLSDDDCLENEDEFIQLEDVKRLQ
KEVNTLKQMVSENDLTRLSTSELDMLETILEAKDKKISQIARSSSLDNEMKTGLREKSIY
FGSYDSDSRLEKHQNHKRKKFSLHKKLGQAFSFDFHDIETKPKSHDMTKHKTPLLKKQKT
LPEFNRGDNQNVYALWNTSNLLRHRVLKDGSESSSQCFKFKNSGSSLPMLISRSLNGGNN
TSVRKSLPSLCGSNGGGGKNPIFAQNSDASVCYVDEVNTKNNCNQKCDFILEKSDNFGLS
DGRSGSTSGFARADDGYSNNSLNNFIKSMGFKMKQVMVGEINTVKNQVPTISKLCDEQSM
LNNIEIHCCADEYCNIERKTTTKEESKVVEDDGTTFDLGQSKPNSPDL
Download sequence
Identical sequences E0W3Q9
121224.XP_002433003 vb|PHUM608060-PA|EEB20265.1|Thyroid XP_002433003.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]