SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1B755 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1B755
Domain Number 1 Region: 1981-2259
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000125
Further Details:      
 
Domain Number 2 Region: 667-854
Classification Level Classification E-value
Superfamily Fibronectin type III 2.25e-44
Family Fibronectin type III 0.00087
Further Details:      
 
Domain Number 3 Region: 856-1051
Classification Level Classification E-value
Superfamily Fibronectin type III 8.51e-40
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 395-445,530-654
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-37
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 5 Region: 1244-1415
Classification Level Classification E-value
Superfamily Fibronectin type III 1.81e-35
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 6 Region: 56-205
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-32
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 1055-1241
Classification Level Classification E-value
Superfamily Fibronectin type III 7.79e-31
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 8 Region: 1427-1615
Classification Level Classification E-value
Superfamily Fibronectin type III 1.65e-30
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 9 Region: 262-394
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-20
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 10 Region: 1631-1731
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000899
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1B755
Sequence length 2298
Comment (tr|E1B755|E1B755_BOVIN) Protein tyrosine phosphatase, receptor type Q {ECO:0000313|Ensembl:ENSBTAP00000045240} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PTPRQ OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MDFLIIFLLLFIGTSETQADVSNAVPGTRYEVTISSISATTYSSPVSRTVATNVTKPGPP
VFLAGERVGSAGILLSWNTPPNPNGRIISYIVKYKEVCPWMQATYTQVRTKPDSLEVLLT
NLNPGTTYEIKVAAENSAGIGVFSDPFLFQTAESAPGKVVNLTVEAFNYSAVNLIWYLPR
QPNGKITSFKISVKHARSGIVVKDVSIRVEDILTGKLPECNENNESFLWSTTSPSPTLGR
VTPPPRTTYLSSVLSQSRLALCKEPISLVTHLRPYTTYLFEVSAVTTEAGYIDSTIVRTP
ESVPEGPPQNCLTGNITGRSFAISWDPPTVVTGKFSYRVELYGPSGRILDNSTKDLKFAF
TNLTPFTVYDAYVAAETSAGIGPKSNISVFTPPEAPGAVFDLQVAEVEATEIRITWKKPR
QPNGIINQYRVRVLVSETRVILEDTLLIGKDEVQYINPMAPETVSIVESMAGLFEGSAEM
SSDLYSLASVIYNSHPRNYFPVRGRAEDQPSTFGTSRNQYITDIAAEQLSYVIRRLVPFT
EHMISVSAFTIMGEGPPTVLSVRTLEQVPSSIQVINYKNISSSSILLYWDPPEYPNGKIT
HYTIYAMELDTNRAFQMTTIDNNFLITGLKKYTRYKMRVAASTTVGESSLSEANDIFVRT
PEDEPESSPQDVEVTDVTASEISLKWSPPEKPNGIIVAYEVLYRNVNSLFMKNTSTTNII
LRDLKPYSLYNVSVRSYTRFGHGEQLSSVLSVRTSETVPDSAPENITYRNISSGEIELSF
FPPSSPNGIIQKYTIYLMKSNGNEERTINTTSLVQNIKGLKKYTQYTIEVSASTLKGEGI
RSAPINVLTEEDAPDSPPQDFSVKQLSGVMVKLSWQPPLEPNGIILYYTVYVWDRSSLKT
VNVTETSLEFSDLDHNVEYNAYVTASTRFGDGEKRSNIINFRTPEGAPSDPPKDVQYSNL
SSSSILLFWTPPSKPNGIIQYYSVYYRNTSGTFIQNFTLHEVNDFDNMTVSAIIDKLAIF
SYYTFWVTASTSVGNGNKSSGIVHVYTDQDIPEGVVGNLTYESISSTAVNVSWGPPSQPN
GLVFYYVSLSSQQTPRHVRPPLVTYERSMYFDNLDKYTDYILKVTPSTEKGFSDAYTAQL
HIRTEEDVPETSPIINTFKNLSSTSVLLSWDPPVKPNGAIISYDLTLQGPSENYSFVTSD
NYVILEELSPFTLYSFFAAARTIKGLGPSSVLFFYTDESVPLAPPQNLTLVNYTSDLVWL
KWSPSPVPGGIVKIYSLKIHEHETDTIFYKNISGFQTEAKLVGLEPVSTYSISITAFTKV
GNGNQFSNVVKFTTQESVPDVVQNIQCMATSWQSASVKWDPPKKANGIITHYTITVERNA
TNISPQDHTYTFMKLLANTSYVFEIRASTSAGEGNEMTCNVSTLPETVPSVPMNIAFSNV
QSTSATLTWMRPDSIFGYFQNYKITTQLRAKKCREWDSEDCVEHQKIQYLYEADLTEETV
YGLKKFRWYRFQVAASTNAGYGNASNWISTQTLPGPPDGPPENVHVVATSPFSINISWSE
PTVITGPTFYLIDVKSVDSDEFNISLIKSNEENKTIEVKDLEIFTRYSVVITAFTGNISA
AYVDGKSSAEIIVTTLESVPKDPPNNMTFQKIPDEVTKFQLTFLPPSQPNGNIQVYQALV
YREDDPTAVQIHNLSIIQKTDTSVIAMLEGLKGGHTYNISVYAINSAGAGPKVQMRITMD
IKAPARPKTKPTPIYDATGKLLVTSTTITIRMPICYYNDDHGPIKNVQVLVAEAGAQHDG
NVTKWYDAYFNKPRPYFTNEGFPNPPCTEGKAKFSGSEEIYIIGADHACMIPGNEDKICN
GPLKPKKQYLFKFRATNIMGQFTDSDYSDPVKTLSEGLSERTVEIILSVTLCILSIILLG
TAVFAFARIRQKQKEGGTYSPRDAEIIDTKFKLDQLITVADLELKDERLTRLLSYRKSIK
PISKKSFLQHVEELCTNNNLKFQEEFSELPKFLQDLSSTDADLPWNRAKNRFPNIKPYNN
NRVKLIADASIPGSDYINASYVSGYLCPNEFIATQGPLPGTVGDFWRMVWETRAKTLVML
TQCFEKGRIRCHQYWPEDNKPVTVFGDIVITKLMEDVQIDWTIRDLKIERHGDCMTIRQC
NFTAWPEHGVPENSAPLVHFVKLVRASRAHDTTPMIVHCSAGVGRTGVFIALDHLTQHIN
DHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCVLDLLSSKGNNQLICFVNYSALQKMD
SLDAMEGDVELEWEETTM
Download sequence
Identical sequences E1B755
ENSBTAP00000045240 ENSBTAP00000045240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]