SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1B781 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1B781
Domain Number 1 Region: 24-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000151
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1B781
Sequence length 79
Comment (tr|E1B781|E1B781_BOVIN) Epidermal growth factor-like protein 7 precursor {ECO:0000313|Ensembl:ENSBTAP00000040380} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
XGSCVLPGRCHCPAGWQGNACQTDVDECSAGEGGCPQRCVNTAGSYWCQCWEGHRPSVDR
AVCLPERGAPRVTPDPTTG
Download sequence
Identical sequences E1B781
ENSBTAP00000040380 ENSBTAP00000040380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]