SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1B7Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1B7Z6
Domain Number 1 Region: 15-104
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-36
Family SCAN domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 484-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000313
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 452-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000108
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 573-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000145
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 219-249
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000484
Family KRAB domain (Kruppel-associated box) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1B7Z6
Sequence length 631
Comment (tr|E1B7Z6|E1B7Z6_BOVIN) Zinc finger protein 496 {ECO:0000313|Ensembl:ENSBTAP00000051748} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF496 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
CAPESWLQRKGELPNPESSRRLFRRFCYQEAAGPREALHRLWDLCRGWLRPERHTKEQIL
ELLVLEQFLAILPREVQGWVRAQEPESGDQAVSAVEALEREPGRPWQWINNTLNVQVIDH
WEEFPSHLPLFAESFASQKCRQELVRGEKSHENIAEALDSPGLHEVESLILIRDPLHFYK
PSWLICSLPNTQNSSVSVSMGSLGPVSLGIIRNLSQNRVSPFKDMIFCFSEEDWSLLDPA
QTGFYGEFIIGEDCGVSLPPNDAAAQLDLSQGEENEPRVPELQDFQVPAVPPGLLSLGTL
SWHRADQYSTRHPHLEQAARASETVLRESPGLLLDHSLTSLKMPFPGSAAAVGKMNFSFS
SLERLSKSPAIPGRTHNFPICTPLFPHNPYLFRHLNSHCTQSPHTCALISGDEDSQLGPY
CTDEPRSPTEKQHSLPISHRSGIEAAGEVQTSSKKSYVCPNCGKIFRWRVNFIRHLRSRR
EQEKPHECSVCGELFSDSEDLDGHLETHEVQKPFRCGACGKSFRLNSHLLSHRRIHLQPD
GLELVKKKEQEASGTTGGDSDDLLTKGKAKLRCQCCDCGKVFQRPEHLARHRSNIHMDKS
QPFQCRYCVKSFSQNSDLLRHQRLHMKRRSK
Download sequence
Identical sequences E1B7Z6
ENSBTAP00000051748 ENSBTAP00000051748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]