SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1B9H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1B9H3
Domain Number 1 Region: 802-890
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000034
Family Myosin rod fragments 0.008
Further Details:      
 
Domain Number 2 Region: 674-741
Classification Level Classification E-value
Superfamily EF-hand 0.0000342
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1B9H3
Sequence length 916
Comment (tr|E1B9H3|E1B9H3_BOVIN) Cell cycle and apoptosis regulator 2 {ECO:0000313|Ensembl:ENSBTAP00000007194} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CCAR2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSQFKRQRINPLPGGRNFSGAASTSLLGPPPGLLTPPVATDLSQNARHLQGGEKQRVFTG
IVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQP
LLKSPAPPLLHVAALGQKQGILGAQPQLIFQPHRIPPLFPQKPLSLFQTSHTLHLSHLNR
FPARGPHGRLDQGRSDDYDSKKRKQRAGGEPWGAKKPRHDLPPYRVHLTPYTVDSPVFDF
LELQRRYRTLLVPSDFLAVHLSWLSAFPVSQPFSLHHPSRIQVSSEKEPAADAGAEPPPT
DSDPTYSSKVLLLSSPGLEELYRCCMLFVDDMAEPRETPEHPLKQIKFLLGWKDDEAVLV
GGEWSPSLDGLDPKGDPQVLVRTATRCAQAQAGIDLSACTKWWRFAEFQYLQAGPPRRLQ
TVVVYLPDIWTIMPTLEEWEALCQQKAAEAAPPPPEVPVETEPTEQPADGSEQAADTSKS
AENPEVTAQQEVDTDLPEAPPPPLEPAVMARSRCVNLSLQSIVEDRRPKERISFEATVLA
ELFLEMLQRDFGYRIYKTLLSLPEKVVAPPEPEKEEAAKEEEAVKEEAKESKDEVQSEGT
AAEADAPPKEDGLLPKPPSSGGEDEEKPRGEASEDLCEMALDPELLLLRDDGEEEFAGAK
LEDSEVRSVASNQSEMEFSTLQDMPKELEPSAVLPVDCLLAFVYFDANWCGYLHRRDLER
ILLTLGLRLSAEQAKQLVSRAVSQNICQYRSLQYSRPEGPDGALPEDLLFGNLDLLPPPG
KSGKPGTTPVEHKGLVSHNGSLINVGNLLQRAEQQDSGRLYLENKIHTLELKLEESHNRF
SATEVTNKTLATEMQDLRARLAEAEEMARTAERQKNQLQRLLQEFRRRLTTLQLDTQRML
EKADSWVEKEEPAPSN
Download sequence
Identical sequences E1B9H3
ENSBTAP00000007194 9913.ENSBTAP00000007194 NP_001068766.2.59421 NP_001068766.2.76553 XP_005210285.1.76553 XP_019821882.1.53367 XP_019821883.1.53367 ENSBTAP00000007194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]