SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1B9J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1B9J8
Domain Number 1 Region: 440-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-23
Family KRAB domain (Kruppel-associated box) 0.00085
Further Details:      
 
Domain Number 5 Region: 261-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-20
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 6 Region: 495-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.99e-16
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 402-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000418
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1B9J8
Sequence length 571
Comment (tr|E1B9J8|E1B9J8_BOVIN) Zinc finger protein 10 {ECO:0000313|Ensembl:ENSBTAP00000053058} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF10 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MEAELLTVRSHTLVTFKDILVNFTREEWKLLDTAQQIMYKDVMLENYRNLVSLGHQLPKP
DVILRLEKGEEPWLVEREIHQETQPDLETSVEIKSTSHKSISNDKYSCDVKMERMPKSDL
WYLSLEEVWTCGGQLDRPQDSQERHLRQVAFTQKKVLPQERVCENGKYRGNCFLHSQLVL
QEYFCKHDSNPKGLKHNLVFSGHQESCASNSNESSQTFCQNIRLIQFARTQARDKSYRCP
DNNSLTHGTSLGISKGVHREKPYECKECGKFFSWRSNLTRHRLIHTGEKPYECKECGKSF
SRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRIHTGDKLYTCNQCGKSFVHSS
RLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECSECGKSYSQRSHLVV
HHRTHTGLKPFECKDCGKCFSRSSHLFSHQRTHTGEKPYECHDCGKSFSQSSALIVHQRI
HTGEKPYECCQCGKAFIRKNDLIKHQRVHVGDETYKCNQCGIIFSQNSPLIVYQIAHTGE
QFLTCNQCGTALVNTPNVIRYQTNIIRENAY
Download sequence
Identical sequences E1B9J8
ENSBTAP00000053058 ENSBTAP00000053058 XP_010812163.1.76553 XP_015322556.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]