SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BB30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BB30
Domain Number 1 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 4-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-23
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 4 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-22
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 207-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 469-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.03e-17
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BB30
Sequence length 548
Comment (tr|E1BB30|E1BB30_BOVIN) Zinc finger protein 354C {ECO:0000313|Ensembl:ENSBTAP00000021140} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF354C OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MGLPLQESVTFRDIAVLFSRDEWLHLDAAQRTLYREVMLENYSTLVSLGIPFSMPKLICQ
LQQGEDPCMVEREIPQDTCLGFKIWPEIEALPRKQDISSGETSQGIIMKNSIKLDIKCGE
ALEFEGRTQEQQKKTLRQMVASQKQTISRTGDQTSLELGKGLFINTVLIRQQNVPTERVP
SVYYTFGRDFKQNFDLMRCFQIYPGEKPHIYNACDKSFNQSLHLIERQRIHTGEKPYKCS
ECGKTFSHRSSLLAHQRIHTGEKPYKCNQCEKAFSSSSTLIKHLRVHTGEKPYQCKDCGK
AFSQCSTLTVHQRIHTGEKLYKCGECEKAFNCRAKLHRHQQIHTGEKPYKCSECGKSYSQ
FTSLAEHQRLHTGEQLCKCLECGRNFTRISTFIEHQRIHTGQKPYQCNECGKAFNQYSSF
NDHRKIHTGEKLYTCGECGKAFGCKSNLYRHQRIHTGEKPYQCNQCGKAFSQYSFLTEHE
RIHTGEKLYKCMECGKAYSYRSNLCRHKKVHNKEKLYKWKEYGNQLCCLSNSKLQYEFSF
KGSHMIEI
Download sequence
Identical sequences E1BB30
ENSBTAP00000021140 ENSBTAP00000021140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]