SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BB35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BB35
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily EF-hand 8.77e-17
Family S100 proteins 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BB35
Sequence length 494
Comment (tr|E1BB35|E1BB35_BOVIN) Cornulin {ECO:0000313|Ensembl:ENSBTAP00000026035} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CRNN OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MPQLLRNINGIIEAFRRYARMEGDCAVLERGELKRLLEKEFADVIVKPHDPATVDEVLRL
LDEDDTGTVEFKEFLVLVFKVAQACFETLSEGPEGVCGSQESGRGAPAATQEPGAGQRSS
TAVGRPGNRQGPAGSSDSQSEQASRGPGGPGPQTQGQDISCAQVSHQDRQSESQRQEGVS
QSTQARGHVEQAQRMREDKSSQTRERGTERQLQASNQDRAHQTSETITGTITQTRTSATQ
AVEQDRSHQTGSASTHTSTQPRESTRGTETHSQDGNQTSQVVTGGHVQAETRPQTQIHTH
TTEQDRSHQTGSTSTQPQESTRESTRGTETHSQDRYQTRQVVTGGHIQTQGGAPQAMEQD
RGQITRHTGAGEQGQPQRQSGSSQRQTQVSNCEAGETVLGGQAQTGASTVTGRQDRSSTH
PPSSATGGQGERDPTVVHQEWVDDHTRETVIRRQDQGSLHASVPSAQGREAAPPDGKRGL
TARGLYSYFKSSKP
Download sequence
Identical sequences E1BB35
ENSBTAP00000026035 ENSBTAP00000026035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]