SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BBG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BBG2
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.55e-34
Family Calponin-homology domain, CH-domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 190-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000927
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 159-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000187
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BBG2
Sequence length 853
Comment (sp|E1BBG2|MILK1_BOVIN) MICAL-like protein 1 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=MICALL1; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAGPRGALLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVF
ENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFAGSGPAGVSSPRK
GLVLSSPPSEASTPADPGDRAQGEECSSGSLSKQGSHRTPSSTCAACQQHVHLVQRYLAD
GKLYHRHCFRCRRCSSTLLPGAYRNGPEEGTFVCAEHCARLGPSGRSGARPGTPPQPKQQ
QLTEEAKEVEGGSPSPKATAGAEADVPKASPEGRPQVPTKPRVPGRPQELASPPASRPTP
APRKASESTAPTPPTPRPRSSLQQENLVEQGGGSGLVNGKLQEPPIPKPRGTPKLSERTP
APRKDPPWITLVQAEPKKKPAPLPPSSSPGPPPGQEGRQVENGGVDKAAPRGPEPKPYNP
FEEEEEEPPAAPSPAPGPAPTPPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSTSPLTL
HASRLSRSEPPSATPSPALSVESLSSESSSQAPSEELLEPPVVPKSSSEPAVHAPGTPGT
SASLSANSSLSSSGELVQPSMDRTPQASPGLAPNSRGSPGPPPAKPCSGTAPTPLVLVGD
KSPAPSPGTSSPQLQVKSSCKENPFNRKPSPTASPSVKKATKGSKPARPPAPGHGFPLIK
RKVQSDQYIPEEDIHGEIDTIERQLDALEHRGVLLEEKLRGGVNEGREDDMLVDWFKLIH
EKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRGREKVLMQELVT
LIEQRNAIVNCLDEDRQREEEEDKMLEAMIKKKEFQKETEPEGKKKGKFKTMKVLKLLGN
KRDTKSKCPGDRS
Download sequence
Identical sequences E1BBG2
ENSBTAP00000026064 ENSBTAP00000026064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]