SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BBH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BBH1
Domain Number 1 Region: 1145-1243
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-24
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BBH1
Sequence length 1254
Comment (tr|E1BBH1|E1BBH1_BOVIN) Pleckstrin homology like domain family B member 2 {ECO:0000313|Ensembl:ENSBTAP00000001599} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PHLDB2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAEQSHMQKQLDLQNGSLEAGFAENSLENDSQNMMESLSPKKYSSSLRFKANGDCSGSYL
TLSQPVPAKRSPSPLGTSVRSSPSLAKIQGTKQFSCDGSEKSISMKPPTPLRSTSPSLSG
YALGRADFDHFLGRDAERSLRLSEKPPYSKYSSRNKSHDNVYFLGGLEGRKASGSLLTMW
NGSSLSDTGSSPINRSGAASMPSSPKQARKISIQDNLTLQPKLSRHRDPASENISLRTRK
YSSGSLSHMGAYSRSLPRLHRATENQLAPLSLPPRSSLGNSKRTKLGEKDLPHCIIDNDN
YLNFSSLSSGALPYKASASEGSAYVSSTLSVPASPRVARKMLLASTSSCTSDDLDRASYS
GTSPGHSFPPGELDRAFAARRNFSCGSVEFDDADLDSLRQASGTPQPVLRERKSSISSIS
GRDDLMDYHRRQREERLREQEMERLERQRLETILSLCAEYTKPDSRVSPGTTVADVQKIN
KELEKLQLSDEESVFEEALVSPDTRYRCHQKSALHDADLAGFGSLSQSSASFLPPRGARN
DELLGDLARTPPPPSSAFLKASGESAYLSILPKTPEGISEEQRIQELTAMEETRIAILNN
LEELEQKIKDINDQMEESSRELDMECALLDGEQKSETTELMKEKEILDHLNRKITELEKN
IVGEKTKEKVKLDAEREKLERLQELYSEQKTQLDNCPESMREQLQQQLKRDADLLDVESK
HFEDLEFQQLERESRLDEEKENLTQQLLREVAEYQRNIVTRKEKISALKKQANHIVQQAQ
REQDHFVKEKNNLIMMLQREKENLCNLEKKYSSLSGGKGFPVTPNTLKEGYIIVNEINES
CGSSTNLPPSTQFPADADATAAGPTTAVLMSQPQSKEHFRSLEERKKQHQEGLYLSDTLP
RKKTTPSISPHFSSATMGRSTTPKGHLPLGQSNSCGSVLPHSLATMTKDSESRRMLRGYN
HQQMSEGQRQKSSEFYNRTASESNVYLNSFHYPDHSYKDQAFDTLSLDSSDSMETSISAC
SPDNISSASTSNIARIEEMERLLKQAHAEKTRLLESREREMEAKKRALEEEKRRRELLEK
RLQEETSQRQKLIEKEVKIREKQRAQARPLTRYLPVRKEDFDLRSHVETAGHNIDTCYHV
SITEKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHEAKLKGVIYFQAIEEVYY
DHLKNANKSPNPLLTFSVKTHDRIYYMVAPSPEAMRIWMDVIVTGAEGYTHFLL
Download sequence
Identical sequences E1BBH1
ENSBTAP00000001599 ENSBTAP00000001599 NP_001193237.1.59421 NP_001193237.1.76553 9913.ENSBTAP00000001599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]