SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BD47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BD47
Domain Number 1 Region: 46-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-39
Family SCAN domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 638-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 582-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.26e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 680-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.31e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 362-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BD47
Sequence length 749
Comment (tr|E1BD47|E1BD47_BOVIN) Zinc finger protein with KRAB and SCAN domains 7 {ECO:0000313|Ensembl:ENSBTAP00000023585} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZKSCAN7 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MATQGRGTSGLFPRGAVLQRQEGCLTVKQEPGSPTWGHGCSLQKNHPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQMHHPE
SGEEAVAVVEDFQRYVSGPGEVSTPGQEQEIHSEEKTALGATHESPSTSPHSEGSAPGAH
LEPPRDPGAHHHLSTQSASPVPTLPQVGNLRNQVVATVLSMVRPQEAAELEFLSVNYSQK
WKGAALSQGALYQNIMLENCHSLAPLDENRMVHSQLPPKQDISEELKSSDRILGVFCGVI
PAGQEAGTASKEASENLEVQPSDEEGTRLDSDFLEITQEDKKKSTEDQYDDYKELGGHLD
LSSSLSEHQGVLKGQKLYHCDECDKAFNRSSHLIGHQRIHTGEKPYECSECGKTFRQTSQ
LVVHLRIHTGEKPYECSDCGKTYRHSSHLIQHQRLHYGEKPYKCNECAKAFTQSSQLIDH
QRTHSGEKPYECNECGEAFIRNKSLIRHQVLHTGKKPYKCDECGKAFCSNRNLIDHQRIH
TGEKPFECNECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLADHERIHTGEK
PFECNECGKAFGLSKCLIRHQRLHTGEKPYKCKECGKSFNQNSHLIIHQRIHTGEKPYEC
NECGKVFSYSSSLMVHQRTHTGEKPYKCKDCEKAFSDSSQLIVHQRVHTGEKPYECIECG
KAFSQRSTFNHHQRIHTGEKHSGLARSVS
Download sequence
Identical sequences E1BD47
ENSBTAP00000023585 ENSBTAP00000023585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]