SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BDQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BDQ3
Domain Number 1 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 468-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.38e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BDQ3
Sequence length 529
Comment (tr|E1BDQ3|E1BDQ3_BOVIN) Zinc finger protein 35 {ECO:0000313|Ensembl:ENSBTAP00000011532} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF35 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTTELREAVALAHWGPVTVKKEEEEEEGFVGQASSQQVHSENIKVWAPGEAPQTCLPVSE
QEEKGQNMFWDMAVVLKPTQEAPAASTPGSSSLPGTLAKSELLDTHGNMACLGAETKNRQ
LLVPKIEICDETEKSFIVSGRIQKVDPQGPKLGEACENRNMLKRQRIKREQKDFGQVTVK
DCHLPENLKEEEDQKCPKAEERYTLSSGSVKNQKSQPGQKPFTCGVCGKGFSQSANLVVH
QRIHTGEKPFECHQCGKAFIQSANLVVHQRIHTGQKPYVCSKCGKAFTQSSNLTVHQKIH
SLEKTFKCNECEKAFSYSSQLGRHQKVHITEKCYECNECGKTFTRSSNLIVHQRIHTGEK
PFACNDCGKAFTQSANLIVHQRSHTGEKPYECKECGKAFSCFSHLIVHQRIHTAEKPYDC
SECGKAFSQLSCLIVHQRIHSGDLPYVCNECGKAFTCSSYLLIHQRIHNGEKPYTCNECG
KSFRQRSSLTVHQRTHTGEKPYECAKCGAAFISNSHLMRHHRTHLVEST
Download sequence
Identical sequences E1BDQ3
ENSBTAP00000011532 XP_015314955.1.76553 ENSBTAP00000011532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]