SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BFA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BFA2
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-67
Family Eukaryotic proteases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BFA2
Sequence length 265
Comment (tr|E1BFA2|E1BFA2_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000046934} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
QASLRFQGSNICGAVLINSSWLLSTAHCFLKKSKAPENYQVLLGSIQLYQHTPQTQEISV
SRIITHPDFEKLHPFGSDIAMLQLLFPVNFTSYIIPACLPVPGMKLPSNSSCWIPGWGML
NEESERGHNLLQEGKVSFVENKFCNMLYGLAKGKNVSVQEDMLCAGDFSTGTSICLGDSG
GPLVCDFTSSWVLMGLASWGFDCRHPIYPSIFTNITYFTDWIEEIQRLTPNPEPTSALTP
LPKPTSTPPQTQFPHQSLRAALVCA
Download sequence
Identical sequences E1BFA2
ENSBTAP00000046934 ENSBTAP00000046934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]