SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BFJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BFJ3
Domain Number 1 Region: 539-568,667-744
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000412
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BFJ3
Sequence length 763
Comment (tr|E1BFJ3|E1BFJ3_BOVIN) Solute carrier family 26 member 6 {ECO:0000313|Ensembl:ENSBTAP00000052325} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SLC26A6 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MGLSEAPGERDTQALLSRTQAMELRRRDYHVERPLLNQEQLEELGSRSPAQVTLQWRTWF
RCSRARAQALLLQYLPVLAWLPQYSVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFVYFLFGTSRHISVGTFAVMSVMVGSVMESLAPDDAFLLGLNSTLDVAAR
DATRVQLASTLSVLVGLFQVGLGMVHFGFVVTYLSEPLVRAYTTAASVHVFVSQLKYVFG
LHLSSRSGPLSLIYTVLEVCWKLPQMVVGTMVTAIVAGVVLVLVKLLNEKLRRHLPMPLP
GELLTLIGATGISYGVGLKQAFGVDIVGKIPTGLVPPMAPRPQLFAKLLGNAFAIAVVGF
AIAISLGKIFALRHGYRVYSNQELVALGLSNLLGGIFQCFPVSCSMSRSLVQESTGGNTQ
VAGAISSLFILIIIVKLGELFQDLPKAVLAAVVIVNLKGMVMQCTDVVSLWKANRMDLLI
WVVTFVATILLNLDLGLAVAVVFSLMLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSGARE
VPGVKVFRSSVTVYFANAELYSDSLKQRCGVDVDYLLSQKKKLLRKQELKLKQLQKENKL
PKQAAASKGTSVSINVNPTVMDIESNNDVEGSKAREASAGTELEDTGAWAPEDAKASDIS
SLKALGLPQPDFHTLILDLSSFSFVDTVCLKSLKNIFRDFREIEVEVYMAACHAPVITQL
EDGHFFDASITKQHLFASVHDAVLFALQHRRSGPVNPVLVTKL
Download sequence
Identical sequences E1BFJ3
ENSBTAP00000052325 ENSBTAP00000052325 XP_019840596.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]