SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BGP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BGP1
Domain Number 1 Region: 61-279
Classification Level Classification E-value
Superfamily L domain-like 4.82e-40
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 2 Region: 650-764
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.93e-28
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BGP1
Sequence length 801
Comment (tr|E1BGP1|E1BGP1_BOVIN) Leucine rich repeats and calponin homology domain containing 3 {ECO:0000313|Ensembl:ENSBTAP00000025116} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LRCH3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAAAGLVAVAAAAEYSCPGASGGNLSAVNCGPNSGAGPGPGPGSWSRSLDRALEEAAVTG
VLSLSGRKLREFPRGAANHDLTDTTRADLSRNRLSEIPIEACHFVSLENLNLYQNCIRYV
PEAILNLQALTFLNISRNQLSTLPVHLCELPLKVLIASNNKLVSLPEEIGHLRHLTELDV
SCNEIQTIPSQIGNLEALRDLNVRRNHLVRLPEELAELPLIRLDFSCNKITTIPVCYRNL
RHLQMITLDNNPLQSPPAQICIKGKIHIFKYLNMQACKIAPDLPDYDRRPMGFGSCHEEL
YSGRPYGALDSGFNSVDSGDKRWSGNEPTDEFSDLPLRVAEITKEQRLRRENQYQENHSS
LVVTNGGVEHELDQIDYIDSCTAEEDEDEVRPHKGLDSDSLSSQFMAYIEQRRISHEGSP
IKPIPMREFQKTEDMRRYSHQNRIRVPAEPSSLLSVSPSHNQFSQTDLELHRRREQLVER
TRREAQLAALQYEEEKIRTKQIQRDAVLDFVKQKASQSPQKQHTPLVGECPFPSRRSQHT
DDSALLVSLSGVNQVGYAAPLPPASAFRPLQNDDRSNAVSNSPTTETAHHSPAYSFPAAI
QRNQPQRPESFLFRGAVRTETNKGHASPLLSSSVPTTDLKDPVTRQNSRQREEELELIDQ
LRKHIEYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSPAVPKLTMAKCRRN
VENFLEACRKIGVPQDNLCSPSDILQLNLSVKRTVETLLSLGAHSEESSFVSLSIQLLGF
VAFYCTLMLTLCMLYYWIFPL
Download sequence
Identical sequences E1BGP1
ENSBTAP00000025116 ENSBTAP00000025116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]