SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BGX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BGX5
Domain Number 1 Region: 102-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.85e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 65-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-16
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 314-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000796
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 277-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000221
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BGX5
Sequence length 384
Comment (tr|E1BGX5|E1BGX5_BOVIN) Zinc finger protein 787 {ECO:0000313|Ensembl:ENSBTAP00000003771} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF787 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLSPSPSAAPAGPPPRP
RPPAPYICNECGKSFSHWSKLTRHQRGGGGERPNACADCGKTFSQSSHLVQHRRIHTGEK
PYACSECGKRFSWSSNLMQHQRIHTGEKPYACPDCGRSFTQSKSLAKHRRSHSGLKPFVC
PRCGRGFSQPKSLARHLRLHPELSGPGVAAKVLAASVRRAKAPEEAAAADGEIAIPVGDG
EGIIVVGAPGEGAAAAAAMASTGARAPGPRSRRAPAPKPYVCVECGKGFGHGAGLLAHQR
AQHGDGLGAAGGEEPAHICVECGEGFVQGAALRRHKKVHAVGAPSVCSHCGQNYYRAGGD
DDDEDDDEEAAGGRCSECRGGEGR
Download sequence
Identical sequences E1BGX5
ENSBTAP00000003771 ENSBTAP00000003771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]