SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BH01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BH01
Domain Number 1 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 180-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000446
Family Classic zinc finger, C2H2 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BH01
Sequence length 291
Comment (tr|E1BH01|E1BH01_BOVIN) Snail family transcriptional repressor 3 {ECO:0000313|Ensembl:ENSBTAP00000023305} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SNAI3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MPRSFLVKTHSSHRVPNYGQLETQRDTSGACAACGGLVVPFVLPDKAAPSTSGDPPQPWD
FTSVVAHVSLPLPTFLGNEEAGRALGPGPLEVSLEDPRAGRAPSAPLRDSVNHLNLPPLL
ALPTRWPSILNADGAQAPGCCLPGAERAPCSPGGFPCHRPFHAPAALAGHQQLHCHLQAQ
RCFTCKFCDKEYGSLGALKMHIRTHTLPCLCAICGKAFSRPWLLQGHLRTHTGEKPYTCP
HCSRAFADRSNLRAHLQTHSDTKKYRCKRCAKTFSRMALLARHEEAGCCAP
Download sequence
Identical sequences E1BH01
ENSBTAP00000023305 ENSBTAP00000023305 9913.ENSBTAP00000023305 NP_001179562.1.59421 NP_001179562.1.76553 XP_005218680.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]