SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BH07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BH07
Domain Number 1 Region: 445-683
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.3e-34
Family Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA 0.043
Further Details:      
 
Domain Number 2 Region: 55-190,222-333
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.86e-28
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BH07
Sequence length 759
Comment (tr|E1BH07|E1BH07_BOVIN) Paladin {ECO:0000313|Ensembl:ENSBTAP00000011320} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PALD1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MGTTASTAQQTVSASAPFEGLQDGGSMDGRHSLSVHSFQTTGLHNSKAKSIIPNKVAPVV
ITYNCKEEFQIHDELLKAHYTLGRLSDATPEHYLVQGRYFLVRDVTEKMDTLGTLQSCGA
PNFRQVQGGLAVFGMGQPSLSGFRQVLQKLQKDGHRECVIFCVREEPVLFLRAAEDFIPY
TPRDKQNLHENLQGLGPGVQAERLELAIRKEIHDFAQLSENKYYVYHNTEDLRGEPHAVA
IRGEDDVHVTEEVFKRPLFLQPSYRYHRLPLPEQGAPLETQFDAFVSVLRETPSLLLLQD
AHGPPPALLFSCQTGVGRASLGMVLGTLLLFHRGGTALRPEAAPMKTKPLSMEQLEVVQS
FLHMVPEGRRMVEEVDRAIAACAELHDLKEVVLGSQRELEGSRAQDFPPYKVWGSSSQHG
VQQRALQSLERYFYLILFNYYLHEQYPLAFALSFSRWLCVHPELYRLPVILSSAGPVAPK
DLIALGSLVADDLVSPDALSTIREMDVANFRRVPRLPIYGMAQPSAKALGSVLAYLTDSK
RKLQQVMWVNLREEAVLECDGRTHSLRWPGPPMAPDQLENLETQLKAHLTRPPPDADGPQ
THRFQTCLTMQEVFSQHHGACPGLTYHRIPVPDFCAPREEDFDRLLGALQAALAKDPGTG
FVFSCLSGQGRTTTAMVVAVLAFWHIRGFPEVGEEELVSVPDAKFTKGEFEVVMKVVQLL
PDGHRVKREVDAALDTVSETMTPMHYHLREIIICTFRQV
Download sequence
Identical sequences E1BH07
ENSBTAP00000011320 ENSBTAP00000011320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]