SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BHY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BHY0
Domain Number 1 Region: 528-560,635-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000549
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BHY0
Sequence length 741
Comment (tr|E1BHY0|E1BHY0_BOVIN) Solute carrier family 26 member 5 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SLC26A5 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MDHAEENEILGATKRYYVERPIFSHPVLQERLHKKDKVSDSIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPV
IMYCFFGTSRHVSIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLHESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQI
NAPIYYANSDLYSNALKRKTGVNPAFIMGARRKAMRKYAKEVGNANMANATVVKVDAEVD
GEDGTKPEEDENEIKYPPIVIKSTLPEELQRFMPPGDNIHTIILDFTQVNFIDSVGVKTL
AGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALLELLFHSIHDAVLGSQAREALA
EQEGSAVPPQEDSEPNATPEA
Download sequence
Identical sequences E1BHY0
ENSBTAP00000012245 NP_001179807.1.59421 NP_001179807.1.76553 XP_015324437.1.76553 ENSBTAP00000012245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]