SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BI66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BI66
Domain Number 1 Region: 6-340
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.32e-117
Family Calpain large subunit, catalytic domain (domain II) 0.000000296
Further Details:      
 
Domain Number 2 Region: 501-667
Classification Level Classification E-value
Superfamily EF-hand 2.23e-22
Family Penta-EF-hand proteins 0.00017
Further Details:      
 
Domain Number 3 Region: 346-483
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 0.00000000000034
Family Calpain large subunit, middle domain (domain III) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BI66
Sequence length 669
Comment (tr|E1BI66|E1BI66_BOVIN) Calpain 13 {ECO:0000313|Ensembl:ENSBTAP00000041966} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CAPN13 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAHNQQFPAKTPIIKFKEQDFYSLRDHCLNRGLLFEDETFPAETYSIGLQLLKGKNLSNL
SWMRPKDLLKGKSEPLFILEGASRFDIQQGEAGDCWFLAALGALTQSPQYLQKILIDQSF
SYQYAGIFHFRFWRCGQWVEVVIDDRLPVLNNEYLFVKPRNKREFWPCLLEKAYAKFHGS
YANLHYGYLPDALVDLTGGVVTNISLHSSSSDLMTMVKTAAEAGSLMTCSTLAGPTSESV
TMANGLVSRHAYTVTGAEQIEYRRSWEYLIRLWNPWGKIEWRGRWSDWSPEWQETHDQRK
SQLYEDKDNGEFWMSCQDFRDNFFGLFICNQVPISLDHGSTPHERWSQMMFKDHLIPGNT
EAGYQRGMQYIFSVPDSMENNNVIMSFNIGPQNLKAKDRTFPLKYEVFKVDYQFQHFQDR
LPSTFFSQFRIAEKGIVSETTCNLTECFSLSPGTYVVVVSEGREAVEFLLRIFLKMPNSD
RNLDGSLNLRALQASLPENGSQQSIFYKYAQQGLDIDATQLQSLLNREFLRGPPGDPFSL
DECRSLVALMDLKVNGRLDQEEFSRLWSRLVHCQSVFQNSPKNAGVFLSSDLWKAIRDTD
FLAGISITSELLDLMKLRYSDSTGRVSFPSLVCLLMRLEAMAKAFQNLSKDGKGLYLTEM
EWMNLVMYN
Download sequence
Identical sequences E1BI66
9913.ENSBTAP00000041966 ENSBTAP00000041966 ENSBTAP00000011777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]