SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1BIH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BIH4
Domain Number 1 Region: 626-902
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.97e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000075
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-35
Family Third domain of FERM 0.00016
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-33
Family Second domain of FERM 0.00022
Further Details:      
 
Domain Number 4 Region: 507-596
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-20
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.3e-19
Family First domain of FERM 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BIH4
Sequence length 912
Comment (tr|E1BIH4|E1BIH4_BOVIN) Tyrosine-protein phosphatase non-receptor type {ECO:0000256|PIRNR:PIRNR000927} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PTPN3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTSRLRALGGRINNIRTSELPKEKTRSEVICSVRFLDGLVQTFKVNKQDTGQVLLDMAYN
YLGVTEKEYFGLQHGDDSLDSPRWLEASKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYDSSVHLPGYLSDSQFIPDQ
NEDFLAKVESLHEQHSGLKQSEAESCFINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQTESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWSLGSRNPKKSVNNQYCKKVIGGMVWNPAMQRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
SPKDSDSEVSQNRSPHRESISENSPAQSCLTQKSSSSVSPSSNAPGSCSPDGVDQQFLED
FHRVTKGGSAEDSSQYYCDKNDGDGYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRIN
PESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELALVIRRKAVHS
FADIKSEDELNQLFPEAIFPVCPETGDTLEGSMEQLKKGLESGTVLIQFEQLYRKKPGLA
ITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAAHLMNKYIAAQGPL
PHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMEHGSFHIRCQSEDCTI
AYVFREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDGEPVLVH
CSAGIGRTGVLVTMETAMCMIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRV
YEEGLVQMLDPS
Download sequence
Identical sequences E1BIH4
9913.ENSBTAP00000025085 ENSBTAP00000025085 ENSBTAP00000025085 NP_001192616.1.59421 NP_001192616.1.76553 XP_019822257.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]