SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BII2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BII2
Domain Number 1 Region: 13-70,98-158
Classification Level Classification E-value
Superfamily POZ domain 1.29e-27
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 354-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000106
Family Classic zinc finger, C2H2 0.00082
Further Details:      
 
Domain Number 3 Region: 392-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000238
Family Classic zinc finger, C2H2 0.00068
Further Details:      
 
Domain Number 4 Region: 465-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000382
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 5 Region: 594-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000643
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BII2
Sequence length 687
Comment (tr|E1BII2|E1BII2_BOVIN) POZ/BTB and AT hook containing zinc finger 1 {ECO:0000313|Ensembl:ENSBTAP00000029432} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PATZ1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLA
ACSEYFESVFSAQLGDGGAADGGPADVGGAAAAPGGGAGGSRELEMHTISSKVFGDILDF
AYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGT
SDLGFPLDMTNGAALAANSNGIAGSMQPEEEAARAAGAAIASQASLPVLPGVDRLPMVAG
PLSPQLLTSPFPNVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKV
FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEIC
GKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK
GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
YMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPIPNGGAAFH
CARTYGNKEGQKCSHQDPIESSDSYGDLSDASDLKTPEKQSTNGSFSCDMAVPKNKMESD
GEKKYPCPECGSFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFG
FQIVQSAFASSLVDPEVDQQPLGPEGK
Download sequence
Identical sequences E1BII2 L8HVF1
NP_001178126.1.59421 NP_001178126.1.76553 XP_005908572.1.15283 XP_007170716.1.59432 XP_010827095.1.44457 ENSBTAP00000029432 ENSBTAP00000029432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]