SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BIU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BIU6
Domain Number 1 Region: 883-1048
Classification Level Classification E-value
Superfamily EF-hand 1.09e-25
Family Calmodulin-like 0.021
Further Details:      
 
Domain Number 2 Region: 727-871
Classification Level Classification E-value
Superfamily EF-hand 2.36e-16
Family Calmodulin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BIU6
Sequence length 1150
Comment (tr|E1BIU6|E1BIU6_BOVIN) Protein phosphatase 2 regulatory subunit B''alpha {ECO:0000313|Ensembl:ENSBTAP00000011215} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PPP2R3A OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGVDCIVIHHSVCADLLHIPV
SQFKDTDLDSLFLPHENGFSSAEGDYPHQALTGIPKVRKGSTFQSTCNLKDIAGEAISFA
SGKIKEFSLEKLKNSNHAAYKKGRKVKSDSFNRRSVDFDLLCGHYNHDGNSPSFGLLRSS
SVEEKSLSRRNSLDTNLTSVFLHNFSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCS
EDLKKCTDIIKQCIKKKTGSSINEGNGNDAISSSETVYMNVMTRLASYLKKLPFEFMQSG
NNEAIDLTELVSNMPNLQLTPFSPVFGTEQPPKYEDVVQLSPLDSGQFQTIELQDDQHSY
RKTDTIKPIPNNSTNSLYNLEISDPRTLKDVQLQSQPLTVNPLENVSSGNLMETLYIEEE
SDGKKALYHEQKTENGPSQELIKVNEDRAELSDHGTHLKKCPASMQNEIGKIFEKSVVSL
PEEDLKSKVPKVEEENHRDFINSNSQEEIDKLLMDLESFSQKMETSLREPLAKGKSSNSL
NSQSQLIDQLPDLEPKSKVSSPTEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIEDF
AQELVECKSGRGSLSQEKEMMQILQETLTTSSQANLSVCRSPVGDKVKDTTSVVLIQQTP
EVIKIQNKPEKKPGTPLPPPAPFPSSPRPPSPVPHVNNVVSATLSINIPRFYFPEGLPDA
CSNHEQTLSRIEAAFMDIEDQKADVYEMGKIAKACGCPLYWKAPMFRAAGGERTGFVSAQ
SFITIWRKLLSNHHDDASKFICLLAKPSCSSLEQDDFIPLLQDVVDTHPGLTFLKDAPEF
HSRYITTVIQRIFYTVNRSWSGKITATEIRKSNFLQTLALLEEEEDINQITDYFSYEHFY
VIYCKFWELDSDHDLYISQADLSRYNDQASSNRIIERIFSGAVTRGKTVQKEGRMSYADF
VWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDL
LCQMLDLVKPASDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDSP
EPSDWDRFAAEEYETLVAEESAQAQFQEGSFEDYETEEPPSPSEIGNKGNKIVTSSLSEK
CGKLQSVDEE
Download sequence
Identical sequences E1BIU6
XP_005201978.1.76553 XP_015317626.1.59421 XP_015317627.1.59421 ENSBTAP00000011215 ENSBTAP00000031854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]