SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BIZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BIZ2
Domain Number 1 Region: 275-426
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.67e-41
Family Dual specificity phosphatase-like 0.00025
Further Details:      
 
Domain Number 2 Region: 229-277
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000811
Family DEK C-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BIZ2
Sequence length 1010
Comment (tr|E1BIZ2|E1BIZ2_BOVIN) Slingshot protein phosphatase 1 {ECO:0000313|Ensembl:ENSBTAP00000025062} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SSH1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MFSLFHHAFGRVFVLSLSESFFMVKGAALFLQQGSSPQAQRSLQHPHRHAGDLPQHLQVM
INLLRCEDRIKLAVRLESAWAERVRYMVVVDSSGRQDTEESILLGVDFSSKESKSCTIGM
VLRLWSDTKIHLDGDGGFSVSTAGRMHVFKPVSVQAMWSALQVLHKACEVARRHNYFPGG
VALLWASYYESCIGSEQSCINEWNAMQDLESTRPDSPALFADKPTEGERTERLIKAKLRS
IMMSQDLENVTSKEIRNELEKQMNCNLKEFKEFIDNEMLLILGQMDKPSLIFDHLYLGSE
WNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRVYDEETTDLLAHWNEAYHFINK
AKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWTLEKAYNYVKQKRSITRPNAGFMRQLS
EYEGILDASKQRHNKLWRQQTDDSCLQQPVDDPVGPGDFQPETLDSTPEAPPPCLDATAP
LPEFPGSGALGGAALPCCFRRLSDPLLRAPGDETGGPVHLEDLERDALLEEAAQLAEVSQ
PARHPPEGPGLCEREVTKKPELEPQAEEMEREEALGARRWRQPAAQLDNLLNRENLNNNN
SKRSCPDDLEHDAIFGILNKVKPSYKSCADCMYPAAGGTPEAFGERCKNPGAAAICTQPT
FLPQLTSSPVAGRSRALEKLASGPTNTALFLPPTGSRRPDTGGPGAGAAPEPPASLPEPS
RETHKALPKSLLVKNSHCDKNPPGSEAAKEDLSPKKDPKPAKDLRLLFSKEAEKPTSNSY
LMQHQESIIQLQKAGLVRKHTKELERLKGTPAEPGALCRDGPAAIPEENQDLPLPGQAPG
PEKPEPGPSLLEGAPLKSPPPFLCRPDHASHFSRDFLKTICYTPTSSSMSSNLTRSSSSD
SIHSVRGKPGLVKQRTQEIETRLRLAGLTVSSPLKRSHSLAKLGSLNLSTEDLSSEADVS
SAADSQDARLSESSLLHEPPPAARSPAATSKPSGKSAPENLKSPPWPGKS
Download sequence
Identical sequences E1BIZ2
ENSBTAP00000025062 9913.ENSBTAP00000025062 ENSBTAP00000025062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]