SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BJD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BJD0
Domain Number 1 Region: 105-212
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000169
Family Calmodulin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BJD0
Sequence length 390
Comment (tr|E1BJD0|E1BJD0_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000034710} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MEGSRGRKTKRSPSAKRTSRPPQKPQRLLTQDPGEEQASRTQKGRLQQCAAFLTRKEPAA
ALATGAEQASQRTRQLKGLEATHTVQSDPQTRSQRGSFADKNLLPLTARQLAAFQDVFKL
FSSSPTGSVDMRSMKAALSNVGVQLSPQEMCEALRQADLDGDGTVSFKDFLGVLTDSHRL
AQCLGKVRNSWAYDPQGLQTLFLEMLFKLMSLGYVPFKSVREVMSYYSKKQRSLRLNASW
KGRSRSHGRSGRSHAGLAFFCQAARLIGLSNAELARSLHGLHKAGACSPYSQIPSLNGGT
QPESHTQSRTPRPDVRLPKSYQPSRPKRAPKSGRLSQGRPLRASAGFASQLLGCMCPSKL
APSPPTLIQKQPFSPSPAYLQRPATKKLYK
Download sequence
Identical sequences E1BJD0
ENSBTAP00000034710 9913.ENSBTAP00000034710 ENSBTAP00000034710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]