SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BJS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BJS3
Domain Number 1 Region: 33-161
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.62e-58
Family N-terminal domain of cbl (N-cbl) 0.000000168
Further Details:      
 
Domain Number 2 Region: 248-334
Classification Level Classification E-value
Superfamily SH2 domain 2.09e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 340-418
Classification Level Classification E-value
Superfamily RING/U-box 8.17e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 162-247
Classification Level Classification E-value
Superfamily EF-hand 2.14e-38
Family EF-hand modules in multidomain proteins 0.00000543
Further Details:      
 
Domain Number 5 Region: 849-887
Classification Level Classification E-value
Superfamily UBA-like 0.0000306
Family UBA domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BJS3
Sequence length 900
Comment (tr|E1BJS3|E1BJS3_BOVIN) Cbl proto-oncogene {ECO:0000313|Ensembl:ENSBTAP00000008961} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CBL OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
GGSGGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLA
LKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEG
KERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGE
KTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLR
NWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQ
TIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGS
TFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDP
RGSGSLLRQGAEGAPSPNYEDDDDERADDSLFMMKELAGAKVERPPSPFSMAPQASLPPV
PPRLDLLQQRISIPSSASGLGTASKAPSGSLHKDKPLPIPPTLRDLPPPPPPDRPYSGGA
ETRPQRRPLPCTPGDCPSRDKLPPVPSGRIGEASWLHRPIPKVPVVAPNPSDPWTGRELT
NRHSLPFSLPSQMEPRTDTPRLGSTFNLDTSMNMNSSPLAGAECEHPKIKPSASANAIYS
LAARPLPVPKLPPGEQCESEEDTEYMTPSSRPVGLQKPDVKWPPEIAQSSRSRTCDCDQQ
IDSCTYEAMYNIQSQVAPSVTESGTFGEGNLAAAHANTGPEESENEEDGYDVPKPPVPAV
LARRTLSDISNASSSFGWLSLEGDPPTHFTESAQVPERPPKPFPRRINSERKAGSCQQSS
AAASAAASPQLSSEIESLLSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAHVAT
Download sequence
Identical sequences E1BJS3
ENSBTAP00000008961 ENSBTAP00000008961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]