SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BJY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BJY0
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily EF-hand 2.96e-41
Family Calmodulin-like 0.0000000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BJY0
Sequence length 195
Comment (tr|E1BJY0|E1BJY0_BOVIN) Guanylyl cyclase-activating protein 2 {ECO:0000313|Ensembl:ENSBTAP00000016509} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=GUCA1B OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MGQQFSWEEVEENGAVGAADAAQLQEWYKKFLEECPSGTLFMHEFKRFFKVPDNEEATQY
VEAMFRAFDTNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRQELLDI
VEVKRPWGPPQGKLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDLN
PSSWISQQRRKSAMF
Download sequence
Identical sequences E1BJY0
ENSBTAP00000016509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]