SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1BK00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BK00
Domain Number 1 Region: 1238-1342,1411-1552
Classification Level Classification E-value
Superfamily Cullin homology domain 2.88e-40
Family Cullin homology domain 0.0013
Further Details:      
 
Domain Number 2 Region: 801-993
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.82e-35
Family APC10-like 0.0094
Further Details:      
 
Domain Number 3 Region: 391-465
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.02e-32
Family CPH domain 0.00000674
Further Details:      
 
Domain Number 4 Region: 161-198,686-764
Classification Level Classification E-value
Superfamily ARM repeat 0.00000228
Family Regulatory subunit H of the V-type ATPase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1BK00
Sequence length 1733
Comment (tr|E1BK00|E1BK00_BOVIN) Cullin 7 {ECO:0000313|Ensembl:ENSBTAP00000053839} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CUL7 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDDGEGGSNHVDC
KAEHILLWMSNDEIYANCHKMLGEDGQVIGPSQETAGEAGALDKSVLGEMETDVKSLIQR
ALRQLEECVGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALASHDAGEGQRGEERGAGEGLGQLNISQGPMIGAPDLSRTRTQILFSLSQQEA
IEKHLDFDSRCALLALFAQATLSEHPMSFEGIQLPQVPGRLLFSLVKRYLHVTFLLDQLN
DTAAEPGAPNSTPEELSGERGRLELEFSMAMGTLISELVQAMRWDQVWSRQGPSGQPSGS
IFQPQLVDEGPGLPPAQALPSRRRSRRFRPRSEFASGNTYALYVRDALQPGMRVRMLDDY
EEISAGDEGEFRQSNNGVPPVQVLWESTGRTYWVHWHMLEILGFEEDIENMVEAADEYQG
AAVSAAVGTALPSWRWKPMTELYAVPYVWPEDEDTEESEHLTQAEWWELLFFIKKLDGPD
HQEVLQILQENLDGEVLDDEILAELAVPTELAQDLLLALPQRLDDSALRDLLNCRVYRKY
GPEALAGQLAHPSLLEAWAQPQESADAARVEAKEAPTQGSNTPLQRLAEGFGPAGKIFLD
LEEAFRSEGPQQGEAKPLLLQLQRQPQPFLVLMRSLDTPAANKPLHLAVLRILMQLVDFP
EALLLPWHEAMDACMACLRSPNTDREVLQELILFLHRLASVSRDYAVVLNQLGARDAISK
ALEKHLGKLELAQELRDMVFKCEKHAHLYRKLTTNILGGCIQMVLGQIEDHRRTHRPINI
PFFDVFLRYLCQGSSMEVKEDKCWEKVEVSSNPHRASKLTDRNPKTYWESNGSAGSHRIT
LHMQQGILIRQLALLVASEDLSYMPARVVVFGGDSATSLNTELNSVNVMPSASRVVLLEN
LSRVWPVIQIRIKRCQQGGIDTRIRGLEVLGPKPTFWPVFREQLCRHTRLFYMVRAQAWS
QDIAEDRRGLLHLSSRLNGALRHEQNFASCFLPDEEAAQALGKTCWEALVSPLVQNITCP
DEEGVSPLGWLLDQYLECREAAHNPQSRAAAFSSRVRRLTHLLVHVEPCEAPPSVAATPR
PKGRNRSHDWSSLATRGLPSSIMRNLTRCWRAVVEEQVHSFLTSRWRDDDFVPRYCEHFS
NLQKASSELFGPRAAFLLALQNGCAGALLKLPFLRAAHVSEQFARHIDQRIQGSRIGGAR
GMEMLAQLQRCLETVLIFSGLEIATTFEHYYQHYMADRLLGVGSSWLEGAVLEQIGPCFP
TRLPQQMLRSLSTSEELQRQFHVYQLQRLDQELLKLEDTEKKIQVSRDASASGRGHERGT
GEEAELEAGAVAAAAAAGVAGEEEEEEEEDESEDLYYEGAMPEVSVLVLSPRCWPTASIC
HTLNPRTCLPAYLRGTLNRYSNFYNKRQTYPALERAPQRRLQWTWLGRAELQFGDQTLHV
STVQMWLLLHFNELKAVSVESLLSLSGLPPDVLNQAVGPLTSSRGPLDLDETKDTPAGLL
KIRDSSEEPRPRRGNVWLIPAQTYLKAEDEEGRNLEKRRNLLNCLIVRILKAHGDEGLHI
DQLVCLVLEAWQKGPCPPRGLVSSLGRGSTCGSADVLSCILHLLGKGTVRRQDDRPQMLS
YAVPMTVMEPHTESLNPGSLGPNPPLTFHTLQIRSRGVPYASCTSTQSFSTFR
Download sequence
Identical sequences E1BK00
ENSBTAP00000053839 ENSBTAP00000053839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]