SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BK01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BK01
Domain Number 1 Region: 614-869
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-80
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 276-378
Classification Level Classification E-value
Superfamily SRCR-like 6.41e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000523
Further Details:      
 
Domain Number 3 Region: 494-595
Classification Level Classification E-value
Superfamily SRCR-like 1.27e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000709
Further Details:      
 
Domain Number 4 Region: 383-483
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 5 Region: 164-266
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0017
Further Details:      
 
Domain Number 6 Region: 96-166
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-17
Family Kringle modules 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BK01
Sequence length 871
Comment (tr|E1BK01|E1BK01_BOVIN) Protease, serine 12 {ECO:0000313|Ensembl:ENSBTAP00000027594} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PRSS12 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTLPHFAVALILGALPGVVSFDSVLGYPLHHRHHHAPSRSPQDPYYLTIQRRPQKTLPPP
LPRTLHPAPALRASRAHGLRTPRPPPGDCPAGAPGANVTDSGAPCLRWADVPPFLARSPP
AGWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRRGSVQLRGGKSAFEGTVE
VYENGVWGVVCSSHWDDADASVVCHQLQLGGKGVAKQTPFSELGLIPVYWSNVRCRGDEE
NILLCEKDIWQGGACSEKMAAAVLCSFSHGPAFPILRLVGGSSVREGRVEVYHAGQWGTV
CDDQWDDADAEVVCRQLGLSGIAKAWNQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSW
GEHNCDHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYHRGQWGTVCNDGWTDLNTYVV
CRQLGFKYGKQASANHFEESMGPIWLDGVSCSGKEASFLQCSQRPWGSHDCSHREDVGIS
CYPGGNGFRLSLGFPIRLMDGENKKEGRVEVFINGQWGTVCDDGWTDKDATVICRQLGYK
GPARARSMAYFGEGEGPIHMDNVKCTGNERSLADCVRQNIGDHNCRHSEDAGVICDYLGK
KASGNNSKESLSSVCGLRLLPRRQKRIIGGKNSLRGSWPWQVSLRLKSSHGDGRLLCGAT
LLSSCWVLTAAHCFKRYGNSTRNYVVRVGDYHTLVPEEFEEEIRVEQIVTHRLYRPHSND
YDIALVRLQGPEEQCARLSSHVLPACLPRWRERPQKRAHNCYVTGWGDTGPAYSRTLQQG
AIPLLPKRFCEHRYKGRFTRRMLCAGNLHEHKRVDSCQGDSGGPLVCERLGERWVVYGVT
SWGYGCGVKDSPGVYTEVSAFVPWIKRVTKL
Download sequence
Identical sequences E1BK01
XP_010804183.2.76553 ENSBTAP00000027594 ENSBTAP00000027594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]