SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BK14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BK14
Domain Number 1 Region: 558-744
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-54
Family DBL homology domain (DH-domain) 0.00000000803
Further Details:      
 
Domain Number 2 Region: 749-889
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-38
Family Pleckstrin-homology domain (PH domain) 0.000000168
Further Details:      
 
Domain Number 3 Region: 275-410
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-17
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 4 Region: 1054-1098
Classification Level Classification E-value
Superfamily SH3-domain 0.0000013
Family SH3-domain 0.0029
Further Details:      
 
Domain Number 5 Region: 27-180
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000497
Family CRAL/TRIO domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1BK14
Sequence length 1136
Comment (tr|E1BK14|E1BK14_BOVIN) MCF.2 cell line derived transforming sequence like {ECO:0000313|Ensembl:ENSBTAP00000035199} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=MCF2L OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MVQRLNAVSKRTDEIMHHDISPLCAADIRDQLQKRFAYLSGGRGQDGSPVITFPDYPAFG
DVPDQDFQNVMTYLTSIPSLQDAGIGFILVIDRRQDRWTSVKASILRIAASFPANLQLVL
VLRPTGFFQRTLSDLAFRFNRDDFKMKVPVIMLSSVPELHGYIDKSQLTEDLGGTLAYCH
SRWLRHRTAIESFALLVKQTAQMLQTFGTELAETELPNDVQSTSSVLLAHTEKKDRAKED
MRLALVEGRRVLESIHEPLARSPDQSPNQDQLDSQSTVHRLLAQLNETEAAFDEFWAKHQ
QKLEQCLQLRHFEQDFREVKSALDVLAQKVTTFTDVGNSLAHVQHLLKDLTSFEEKSSAA
VQRARTLSQEGERLIEHKHYAVDSIRPKCHELRHLCDQFAADVERRRGLLGKSLELHGLL
EASMKWCDEGIYLLASQPVDKCQELSKIFQDYEPILTKDLLEHVQRVFQKQESVEEMFHR
RQASLKKLAAKQTRPVQPVAPRPEALTKSPCPSPGIRRGSENHSSEGSALRRGPYRRAKS
EVSEGRQGRGGSTGDEESLAVLRRHVMKELLDTERVYVEELLCVLEGYAAEMDNPLMTHL
ISTGLQNKKDILFGNMEEIYHFHNRIFLRELENYTDCPELVGRCFLERMEEFQIYEKYCQ
NKPRSESLWRQCSDCPFFQECQKKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSKSCE
GAEDLQEALSSILGILKAVNDSMHLIAITGYEGNLSDLGRLLMQGSFSVWTDHKRGHAKV
KDLARFKPMQRHLFLHEKAVLFCKRREENGEGYEKAPSYSYKQSLNMTAVGITENVKGDA
KKFEIWYNAREEVYIIQAPTPEIKAAWVSEIRKVLTSQLQACREASQHRALEQSQSLPLP
TPAGTSPSKASTRNIKKLEERKTDPLSLEGYGGPTPQQRAPEKGKDDAVTSSTSESSALS
KKRFTLQSFAALKAQKASPTSPDKKAKRHQVKSDPTPFGLRGWSKTSHPSETPEDNDGWS
STEEPVNSSDAEEEGRAGPGKLVPGRYTVTRLDEKGVSDVLALRSGDEVELVQEGDEGLW
CVRNLSSGVEGWVPARSLSTLLCQGGPVGCLSSPGWGHLPTELCPEPSAAAAPEDG
Download sequence
Identical sequences E1BK14
ENSBTAP00000035199 ENSBTAP00000035199 9913.ENSBTAP00000035199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]