SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BKA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BKA1
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily EF-hand 1.71e-25
Family S100 proteins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BKA1
Sequence length 101
Comment (tr|E1BKA1|E1BKA1_BOVIN) S100 calcium-binding protein {ECO:0000256|RuleBase:RU361184} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LOC786350 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSGFHLEQAITDLINLFHKYSGSDDTIEKEDLLRLMKENFPNFLSACEKRGRQYLSDIFE
KKDKNKDKKIDFSEFLSLLADIATDYHNHSHGAQLCSGGNQ
Download sequence
Identical sequences E1BKA1
XP_002686048.1.76553 XP_005197767.2.59421 ENSBTAP00000044105 ENSBTAP00000044105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]