SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BKC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BKC2
Domain Number 1 Region: 113-395
Classification Level Classification E-value
Superfamily L domain-like 4.42e-50
Family Ngr ectodomain-like 0.0044
Further Details:      
 
Domain Number 2 Region: 409-724
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.74e-43
Family Rhodopsin-like 0.0005
Further Details:      
 
Domain Number 3 Region: 42-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BKC2
Sequence length 755
Comment (tr|E1BKC2|E1BKC2_BOVIN) Relaxin receptor 2 precursor {ECO:0000313|Ensembl:ENSBTAP00000020135} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=RXFP2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
ALIPFLVELMFGMTVIILNVIIKNITQRNCKTDCALTEGSTITPLCPKGYFPCGNLSQCL
PRAFHCDGVEDCGNGADEENCGDTSGWATIFGTVHGNANNVALTQECFLDQYPQRCVCKG
TELECVNAGLKSVPVVSSNVTLLSLKKNNIHSLSDKVFIKYTELKKIFLQRNCITYISRK
AFFGLHNLQILYLNHNCITTLRPGVFKDLHQLTWLILDDNPISRISQRLFTGLNSLFFLS
MVNNHLQVLPKQMCAQMPQLNWMDLEGNGIKFLTNSTFLSCSSLTVLFLPRNQIGFVPEK
TFSSLKNLGELDLSSNMISELPPHIFKDLKCLQKLNLSSNPLLYLHKSQFGSLKQLQSLD
LERIEIPNINTRMFQPMKNLSYIYFKNFRYCSYAPHVRICMPLTDGISSFEDLLANNILR
VFVWVIAFITCFGNLFVIGMRSFIKAENTTHATSIKILCCADCLMGVYLFFIGLCDLKYR
GQYQKYALLWMESLQCRLLGFLAMLSTEVSVLLLTYLTLEKFLAVVFPFSNIRPGKWQTL
AVLICIWIVGFLIAVTPLWKEDYFGNFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNL
LAFLIIVFSYTVMFCSIQKTALQTSDERSHMGREVAVANRFFFIVFSEAICWIPVFVIKI
LSLSRVEIPDTITSWVVIFFLPVNSALNPILYTLTTSFFKDKLKQLLHKHRRKSIFKTKK
KSVSTSIMWADDSSALKPGALSKINLEDNIVKPIS
Download sequence
Identical sequences E1BKC2
ENSBTAP00000020135 ENSBTAP00000020135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]