SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BKI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BKI7
Domain Number 1 Region: 21-165
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000174
Family S100 proteins 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1BKI7
Sequence length 215
Comment (tr|E1BKI7|E1BKI7_BOVIN) EF-hand calcium binding domain 9 {ECO:0000313|Ensembl:ENSBTAP00000011687} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=EFCAB9 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MKLKQGSFLWYLYLDKLYCLLSVRNVKALVEYFHLLDVHHKKTLNDVLFYHFLHHVTDLT
RNQITVVFNMLDWNAVGEIGFDQFYMLVCILLAQENHLEEQFIFRHSRPVFELLDLDGEL
KIGPDHLHMYNFLFNIKKQQLRDLYYNFDITGDRKLLNYKEFKLFTIFSMDKYQESQKAE
KEKKKEKAVLKKKLSQHVPVLLLLFRPILSTRSLC
Download sequence
Identical sequences E1BKI7
9913.ENSBTAP00000011687 ENSBTAP00000011687 ENSBTAP00000011687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]