SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BKU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BKU6
Domain Number 1 Region: 110-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-24
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 54-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 158-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000148
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1BKU6
Sequence length 182
Comment (tr|E1BKU6|E1BKU6_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000031695} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LOC790396 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
QKSNLIRHQRTHTGEKPFICKECGKTFSGKSNLTEHEKIHIGEKPFKCNECGTAFGQKKY
LIKHQNIHAGEKPYECNECGKAFSQRTSLIVHERIHSGDKPYECNVYGKAFSQSSSLTVH
VRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIH
TH
Download sequence
Identical sequences E1BKU6
ENSBTAP00000031695 ENSBTAP00000031695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]