SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BM27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BM27
Domain Number 1 Region: 2-124,158-265
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.67e-71
Family Calponin-homology domain, CH-domain 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BM27
Sequence length 1010
Comment (tr|E1BM27|E1BM27_BOVIN) Calmin {ECO:0000313|Ensembl:ENSBTAP00000026533} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CLMN OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
VERENVQKRTFTRWINLHLEKCNPPLEVKDLFIDIQDGKILMALLEVLSGRNLLHEYKSS
SHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNPSLVLGLIWNIILFFQIKELTGNL
SRNSPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIRTLLAWVQRKTRKYGVA
VQDFAGSWRSGLAFLAVIKAIDPSLVDMKQALEDSMRENLGEAFSIAHDALHIPRQIKKK
YIMVDTPDEQSIVTYVAQFLEHFPELEAEDFVDSDKEAPIESTFVRIKETPSEQESAIFL
LTEDGERAYTINHEASHPPPSKVFVCDKPEDAKEPWLGGVSSQELVDSSSEFMNQIIEQV
LQGIPGKLNSTSEPAPESSILSSRKDSRRSNSLPIKKTVHFEADTYKDASCSQDPFYSAD
LHFEGSPGESKESSKQDERVLAADAAEQTPKREAPEILEVASNEVPGDMSSVDGEISHPP
TSWTSPSWNGASERASSPGDEGHLPSPPGENTVMASALEIKVKLLTVEAMDKEDYFEAIP
LKASKFNSDLIDFASTSQAFNEVPSPHEKKPAEEELSEDHPERLGKRRGKSAHKKTDSDE
APVKLDQPDPHKDPGDQDQGYSLAPEEALVDKKPEVYEKAKRKSFRRRRRGEEEGEAECL
RGLGGELPSNPPRSSVSLETLRSPSEEGLDFKPSPPLSKISVIPHDLFYYPHYEVPLAAV
LEAYAEGSEDLKNEEMDLEEPEAYLLDLGAREDEPEEAEASQSSFSFSGLGEDLPQASIA
EDASPASEPSPQPSPEDHQQREAKDSVPVQGHQSQESPNSENLASPLEEKVMEESISSKK
KEKRKHVDHVESSIFVAPGTVRSSDDLEEDTGDHKVLSRTSHSDSSIYIRRHTNRSLESD
HFSYVQLRNAADVDDRRNRMLTRYNTQKLTELILQFYGIRADMKREWKHARMSMQKANHS
GKARLREIHSSQSDSLTQLVQQPDVMYFILFLWLLVYCLLLFPQLDVNRL
Download sequence
Identical sequences E1BM27
ENSBTAP00000026533 ENSBTAP00000026533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]