SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BM64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BM64
Domain Number 1 Region: 382-508
Classification Level Classification E-value
Superfamily EF-hand 2.04e-43
Family EF-hand modules in multidomain proteins 0.00000949
Further Details:      
 
Domain Number 2 Region: 511-605
Classification Level Classification E-value
Superfamily EF-hand 1.5e-34
Family EF-hand modules in multidomain proteins 0.0000355
Further Details:      
 
Domain Number 3 Region: 587-673
Classification Level Classification E-value
Superfamily RING/U-box 8.24e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 220-341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000259
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 5 Region: 344-381
Classification Level Classification E-value
Superfamily WW domain 0.0000000000116
Family WW domain 0.00021
Further Details:      
 
Domain Number 6 Region: 79-176
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000187
Family Spectrin repeat 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BM64
Sequence length 960
Comment (tr|E1BM64|E1BM64_BOVIN) Dystrophin-related protein 2 {ECO:0000313|Ensembl:ENSBTAP00000002564} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=DRP2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MQPMVMQGCPYTLPRCHKWREADNFHHSRSLRSTCPQPQVRAAAATPAPPHNGAGVPCLS
PKLFNGSVVAARTLEPPAMNLCWNEIKKKSHNLRARLEAFSDHSGKLQLPLQEIIDWLSQ
KDEELSAQLPLQGDVVLVQQEKETHAAFMEDVKSRGPYIYSVLESAQAFLSQHPFDELEE
PRSESKDTSPRQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIERTLEQLLEIQGAM
EELNATLTQAEGVRATWEPIGDLFIDSLPEHIQALKLFKEEFSPMKDGVKLVNDLAHQLA
ISDVHLSMENSRALEQINIRWKQLQVSVGERLKQLQDAHRDFGPGSQHFLSSSVQVPWER
AISPNKVPYYINHQAQTTCWDHPKMTELYQTLAADLNNIKFSAYRTAMKLRRVQKALRLD
LVTLTTALEIFNEHDLQASEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMSLNWL
LNVFDRPSGRSGKMRALSFKTGIACLCGTEVKEKLQYLFSQVANSGSQCDQRHLGVLLHE
AIQVPRQLGEVAAFGGSNVEPSVRSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHR
VTIAEQVKHQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYY
TPTTSSENMRDFATTLKNKFRSKHYFSKHPQRGYLPVQSVLEADYNETPASSPMLPHADT
HSRIEHFASRLAEMESQNCSFFNDSLSPDDSIDEDQYLLRHSSPVTDREPAFRQQAPHNM
ATGSKGELEKILAHLEDENRILQGELRRLKWQHEEATEVPALTEGSAEVAQGHCNEELLA
EARILRQHKSRLETRMQILEDHNKQLESQLQRLRELLLQPPIESNGNGSAGSSLASSPQQ
SEGSHPQEKGQTTPDTEAADDVGLKSQDVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS
Download sequence
Identical sequences E1BM64
ENSBTAP00000002564 ENSBTAP00000002564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]