SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1BNH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BNH5
Domain Number 1 Region: 202-545,624-648
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.17e-83
Family Myotubularin-like phosphatases 0.0000476
Further Details:      
 
Domain Number 2 Region: 43-186
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000787
Family TFIIH domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BNH5
Sequence length 747
Comment (tr|E1BNH5|E1BNH5_BOVIN) Myotubularin related protein 12 {ECO:0000313|Ensembl:ENSBTAP00000053528} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=MTMR12 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MLGKGVVGGGGGTKAPKPSFVSYVRPEEIHTNEKEATEKEVTLHLLPGEQLLCEANTVLK
CVQEDSCQRGIYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGV
FDEKKKTLFGQLKKYPEKLVIHCKDLRVFHFCLRYTKEEEVKRIVSGIIHHTQAPKLLKR
LFLFSYATAARNSPATDPKKHAVMFDTLQDWCRELERTKGNMKYKAVSVNEGYKVCERLP
AYFVVPAPLLEEDIEFFQGRGIPIWCWSCHNGCALLKMSALPKEQDDSMSQIQKNFSDRI
YRTVHRPPYETAKTEDLSSNFLSLQEIQMAYSKFKQLFLIDNSTEFWDTDIKWFSLLESS
SWLDIIRRCLKKAVEIIECLEAQNMNVLLLEDNASDLCCLVSSLAQVMMDPHCRTVFGFQ
SLVQKEWVMGGHCFLDRCNHLRQSDKEEVPVFLLFLDCVWQLVHQHPPAFEFTETYLTVL
SDSLYIPIFSTFFFNSPHQKDMNVGKESQDSQSRPLNLLTVWDWSVQFEPKAQTLLTNPL
YVEKPKLEKVQRKGTHFKHQRQLSLPLTQSKSSPKRGFFREETDHLIKNLLGKRISKLIN
SSEELQDGFREFYDGWHSRPPSYQGLLLPHLEGPEIKVWAQRYLRWIPEAQILGGGGVAT
MSKLLEMMEEVQRLQEKIEARHHSQEALQAEAASPPRTSGRLSSLFPFALLQRHSSKPVL
PTSGWKALGDEDDLAKREDEFVDLGDV
Download sequence
Identical sequences E1BNH5
ENSBTAP00000053528 ENSBTAP00000053528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]