SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BNT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BNT5
Domain Number 1 Region: 1619-1761
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-51
Family Phosphotyrosine-binding domain (PTB) 0.000000466
Further Details:      
 
Domain Number 2 Region: 228-355
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.19e-40
Family PLC-like (P variant) 0.0028
Further Details:      
 
Domain Number 3 Region: 62-226
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.06e-31
Family Dual specificity phosphatase-like 0.00011
Further Details:      
 
Domain Number 4 Region: 1467-1609
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-22
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BNT5
Sequence length 1767
Comment (tr|E1BNT5|E1BNT5_BOVIN) Tensin-1 {ECO:0000313|Ensembl:ENSBTAP00000003229} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TNS1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
PVNTETAPKNVVDTGEAASRGGNTRKSLEEDSSTRVTPSVQPHPQPIRNMSTSRTTEDSC
ELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLH
AKVLEFGWPDLHTPALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYMHYS
NISASADQALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIM
HGIPNFESKGGCRPFLRIYQAMQPVYTSGIYNVQGDSQTSICITIEPGLLLKGDILLKCY
HKKFRSPTRDVIFRVQFHTCAIHDLGVVFGKEDLDDAFRDDRFPEYGKVEFVFSYGPEKI
QGMEHLENGPSVSVDYNTSDPLIRWDSYDNFNGHRDDGMEEVVGHTQGPLDGSLYAKVKK
KDSLHGSTGAVNATRPVLSATPNHVEHTLSVSSDSGNSTASTKTDKTDEPAPGPASAPAA
LSPEEKRELDRLLSGFGLEREKQGAMYHPQHLRSRPVGGPAAPSSGRHIVPAQVHVNGGA
LASERETDILDDELPNQDGHSVGSMGTLSSLDGVTNTSEGGYPEALSPLTNGLDKPYPME
PMVNGGGYPYESASRAVSAQAGHTAPMRPSYSTQEGLAGYQREGPHPAWPQSATTSHYGH
DPNGMFRSQSFPETEPQLPPAPARGGSSREAVQRGLNSWQQQQQQQQQQQQPRPPPRQQE
RVHLESLGLSRPSPQPLAEPPMSGLPEFPRAASQQEIEQSIEALNMLMLDLEPATAGAPL
HKSQSVPGAWPGASPLSSQPFSGSSCQSHPLTQSRSGYIPSGHSLGTPEPAPRAPLESVP
TGRPYSPYDYQPCPTGPNQSYHPKSPATSSSSSFLPTTQSSVGPQQPPASLPGLTTQPQL
PPKEVTSDPSRTPEEEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRKRAASDGQYENQSP
EPTSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYKEAFEEMEGTSPTSPPPSG
GAVRSPPGLAKTPLSALGLKPHNPADILLHPTGEPRSYVESVVRTAVAGPRTQEPEPKSF
SAPGAQAYGHETPLRIGTLGGSFVSPSPLSTSSPILSADSTSVGSFPSGESSDQGARTPT
QPLLDSGFRSGSLGQPSPLAQRNYQSSSPLPTAGSSYSSPDYSLQQFSSPEGQARSQFSV
AGVHTVPGSPQARHRTVGTNTPPSPGFGRRAVNPSLAAPSSPSLSHRQVMGPLGTGFHGN
TGSSPQSSAATTPGSPSLGRHPGAHQVSNLHGNVVTAPGSPSLGRHPGAHQGTLASNLHS
NAVASPGSPSLGRHLGGSGSVVPGSPSLDRHVPYGGYSTPEDRRPTLSRQSSASGYQAPS
TPSFPVSPAYYPGLSSPATSPSPDSAAFRQGSPTPALPEKRRMSMGDRAGSLPNYATVNG
KVSSSPVASGMSSPSGGSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEI
SREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFL
IETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANS
TSDLLKQGAACNVLFVNSVDMESLTGPQAISKAISETLAADPTPAATIVHFKVSAQGITL
TDNQRKLFFRRHYPLNTVTFCDLDPQERKWTKTEGGAPAKLFGFVARKQGSATDNACHLF
AELDPNQPASAIVSFVSKVMLSAGQKR
Download sequence
Identical sequences E1BNT5
ENSBTAP00000003229 ENSBTAP00000003229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]