SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BPK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BPK3
Domain Number 1 Region: 387-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000901
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 2 Region: 125-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000759
Family Classic zinc finger, C2H2 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BPK3
Sequence length 568
Comment (tr|E1BPK3|E1BPK3_BOVIN) Zinc finger protein 800 {ECO:0000313|Ensembl:ENSBTAP00000026641} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF800 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MDDNLPDVNDKQSQAINDLLEAIYPSVDKREYIIKLEPIETNQNAVFQYISRTDNPTEVT
ESSSTPEQPEVQIQETSTEQSKTVPVTDTEVETVEPPPVEIVADDVAPPSDEQPQESQAD
LETSDNSDFGHQLICCLCRKDFNSRRGVRRHIRKVHKKKMEELKKYIETRKNPNQSTKGR
SKNVLVPLSRSCPVCYKSFATKANVRRHFDEVHRGLRRDSITPDIATKPGQPLFLDSVSP
KKSFKTRKQKSSSKAEYNLTACKCLLCKRKYSSQIMLKRHMQIVHKITLSGTNSKREKGP
NNTASSSEIKVKVEPADSVESSPPSITHSPQNELKGTNHSNEKKNTPAAQKNKVKQDSES
PKSTSLSAAGGQQKTRKPKLSAGFDFKQLYCKLCKRQFTSKQNLTKHIELHTDGNNIYVK
FYKCPLCTYETRRKRDVIRHITVVHKKSSRYLGKITASLEIRAIKKPIDFVLNKVTKRGP
SRDEAKHSDAKHDGTSNSPSKKYEVADVGIEVKVTKNFSLHRCNKCGKAFAKKTYLEHHK
KTHKANASNSPEGNKTKGRSTRSKALVW
Download sequence
Identical sequences E1BPK3
ENSBTAP00000026641 ENSBTAP00000026641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]