SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BPP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BPP7
Domain Number 1 Region: 774-981
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.66e-75
Family STAT DNA-binding domain 0.00000000742
Further Details:      
 
Domain Number 2 Region: 29-227
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.32e-75
Family STAT DNA-binding domain 0.000000504
Further Details:      
 
Domain Number 3 Region: 593-774
Classification Level Classification E-value
Superfamily STAT 3.73e-62
Family STAT 0.0000000154
Further Details:      
 
Domain Number 4 Region: 460-580
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 4.45e-45
Family Transcription factor STAT-4 N-domain 0.0000181
Further Details:      
 
Domain Number 5 Region: 982-1123
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-43
Family SH2 domain 0.000000126
Further Details:      
 
Domain Number 6 Region: 228-342
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-42
Family SH2 domain 0.0000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BPP7
Sequence length 1162
Comment (tr|E1BPP7|E1BPP7_BOVIN) Signal transducer and activator of transcription {ECO:0000256|RuleBase:RU046415} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=STAT1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTYEGDPIPLQRAHLLERVTFLIYNLFKKLLIKLPELNYQVKVKASIDNNRRFVLCGTHV
KAMSIEESSNGSLSVEFRHLGCHMVTEELHSITFETQICLYGLTIDLETCSLPVVMISNV
SQLPNAWASIIWYNVSTNDSQNLVFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLNM
LAEKLTVQSSYNDGHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYIMGF
VSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALP
FADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEGLFPRKHVGRLFRAVA
PLPPSAKPAVINLTYLWKDKLASKEVGREGIGSRGDGTVAPVSRALVVKKKSEIESRPSP
TTMHFPIIKEHNVLVKCKKLLCEWMKIVSEWKSVGYWPTMSQWYELQQLESKYLEQVHQL
YDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQH
NIRKSKRNLQDNFQEDPIQMSMIICNCLKEERKILDHAQRISQAQSGNIQSTVMLDKQKE
LDSKVRNVKDKVMSIEHEIKTLEDLQDEYDFKCKTLQNREHETNGVAKNDQKQEQLLLQK
MYLMLDNKRKEVVLKIIELLNATELTQKALINDELVEWKRRQQSACIGGPPNACLDQLQN
WFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQALWDRTFSLFQQLIQRLLVKLQ
ELNYNLKVKVLFDKDVNERNTVKGSQPFKYPFPVLSRFRKFNILGTHTKVMNMEESTNGS
LAAEFRHLQLKEQKNAGARTNETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFF
LNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWTRFCKENI
NDKNFPFWLWIESILELIKKHLLALWNDGCIVGFISKERERALLKDQQPGTFLLRFSESC
REGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKFL
YPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMS
PEEFDEVSRMVGSVEFDMMNAV
Download sequence
Identical sequences E1BPP7
ENSBTAP00000030561 ENSBTAP00000053390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]