SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BPV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BPV6
Domain Number 1 Region: 332-436
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.37e-30
Family Calponin-homology domain, CH-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1BPV6
Sequence length 449
Comment (tr|E1BPV6|E1BPV6_BOVIN) Smoothelin like 1 {ECO:0000313|Ensembl:ENSBTAP00000041378} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SMTNL1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MEQKAGKSSEDGATVPPAAEAPEPAGSGGSAEEETAGPAESAARAGPATAGQQERAPAED
AVSAECQADGLGEVKAESQGEVELQQEDPGQGETAAAHGKTDRKDQTDSEPEGAEGDRET
ASASEEQSADEKEARLGSRETVDASREVQAEPKQASGAQEAEAGGGEAEGPQEEGGKTEE
PQAEAREEAGAPAAQPDSEPGSPDEEQDQGAGAEAEDGAGGPPSSPEGWPESPTEEGGSA
SPEGLSPDTAASEELGPSASDSSPSDVPQSPTEPPPSEEKKKEKAPERRVSAPTRPRGPR
AQNRKAIVDKFGGAAAGPTALFRNTKAAGAAVGGVRNMLLEWCRAMTRSYEHVDIQNFSS
SWGSGMAFCALIHKFFPDAFDYAALDPAQRRHNFTLAFSTAEKLADCAQLLEVDDMVRLA
VPDSKCVYTYIQELYRSLVQKGLVKTKKK
Download sequence
Identical sequences E1BPV6
ENSBTAP00000041378 ENSBTAP00000041378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]