SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BTW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BTW5
Domain Number 1 Region: 470-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000394
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 2 Region: 279-408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000832
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 572-698
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000196
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 215-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000237
Family EGF-type module 0.007
Further Details:      
 
Domain Number 5 Region: 504-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000261
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 6 Region: 179-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000989
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 138-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000858
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 549-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BTW5
Sequence length 1060
Comment (tr|E1BTW5|E1BTW5_CHICK) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN= OC=Phasianidae; Phasianinae; Gallus.
Sequence
MINPSRQWQTLKHNTGAAHFEYQIRVTCAEHYYGFGCNKFCRPRDDFFTHHTCDQNGNKT
CLEGWTGPECNKAICRQGCSPKHGSCTVPGECRCQYGWQGQYCDKCIPHPGCVHGTCIEP
WQCLCETNWGGQLCDKDLNYCGTHPPCLNGGTCSNTGPDKYQCSCPEGYSGQNCEIAEHA
CLSDPCHNGGSCLETSTGFECVCAPGWAGPTCTDNIDDCSPNPCGHGGTCQDLVDGFKCI
CPPQWTGKTCQLDANECEGKPCVNANSCRNLIGSYYCDCITGWSGHNCDININDCRGQCQ
NGGSCRDLVNGYRCICSPGYAGDHCEKDINECASNPCMNGGHCQDEINGFQCLCPAGFSG
NLCQLDIDYCEPNPCQNGAQCFNLAMDYFCNCPEDYEGKNCSHLKDHCRTTPCEVIDSCT
VAVASNSTPEGVRYISSNVCGPHGKCKSQAGGKFTCECNKGFTGTYCHENINDCESNPCK
NGGTCIDGVNSYKCICSDGWEGTYCETNINDCSKNPCHNGGTCRDLVNDFFCECKNGWKG
KTCHSRDSQCDEATCNNGGTCYDEGDTFKCMCPAGWEGATCNIARNSSCLPNPCHNGGTC
VVSGDSFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRI
NINECQSSPCAFGATCVDEINGYRCICPPGRSGPGCQEVTGRPCFTSIRVMPDGAKWDDD
CNTCQCLNGKVTCSKVWCGPRPCIIHAKGHNECPAGHACVPVKEDHCFTHPCAAVGECWP
SNQQPVKTKCNSDSYYQDNCANITFTFNKEMMAPGLTTEHICSELRNLNILKNVSAEYSI
YITCEPSHLANNEIHVAISAEDIGEDENPIKEITDKIIDLVSKRDGNNTLIAAVAEVRVQ
RRPVKNKTDFLVPLLSSVLTVAWICCLVTVFYWCIQKRRKQSSHTHTASDDNTTNNVREQ
LNQIKNPIEKHGANTVPIKDYENKNSKIAKIRTHNSEVEEDDMDKHQQKARFAKQPAYTL
VDRDEKPPNSTPTKHPNWTNKQDNRDLESAQSLNRMEYIV
Download sequence
Identical sequences E1BTW5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]