SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1C1R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1C1R3
Domain Number 1 Region: 77-196
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000328
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1C1R3
Sequence length 345
Comment (tr|E1C1R3|E1C1R3_CHICK) Corticotropin-releasing hormone-binding protein {ECO:0000256|PIRNR:PIRNR009279} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=CRHBP OC=Phasianidae; Phasianinae; Gallus.
Sequence
MPRRLLPAGSEQQVLSAHGGAATMPSAFQLQCHLVLILLAASKGDTRYLEVRDAGEDEPF
LLLSEDLKRELSAGHIYRRSLRCIDMLSIEGQFTFTADQPQLHCATFFIGEPEELLTIEY
DFVNIDCQGGDFLKVFDGWILKGEKFPSSLDHPLPTSQRYTDFCESGAVQRSIRSSQNVA
MIFFRIHQPGNGFTITVKKSANLFPCNVISQTPSGRFTMVIPHQHRNCSFSIIYPVVIKI
SDLILGHLNGLFLKNPSVGCAGVGDFVELLGGTGLDPSKMFPLADLCHSFHGSAQMKIGC
DNTVLRMVSSGKHINRVTFEYYQLDLQEIENRKENSIEEFCFPGI
Download sequence
Identical sequences E1C1R3
ENSGALP00000024136 XP_003643006.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]