SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1C6X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1C6X2
Domain Number 1 Region: 357-590
Classification Level Classification E-value
Superfamily HCP-like 5.76e-50
Family HCP-like 0.00013
Further Details:      
 
Domain Number 2 Region: 564-698
Classification Level Classification E-value
Superfamily HCP-like 7.06e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 197-321
Classification Level Classification E-value
Superfamily HCP-like 9.16e-24
Family HCP-like 0.0031
Further Details:      
 
Domain Number 4 Region: 114-169
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-20
Family Fibronectin type II module 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1C6X2
Sequence length 791
Comment (tr|E1C6X2|E1C6X2_CHICK) SEL1L ERAD E3 ligase adaptor subunit {ECO:0000313|Ensembl:ENSGALP00000017201} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=SEL1L OC=Phasianidae; Phasianinae; Gallus.
Sequence
MGWRVRLALLLCVALLWAAGLAAADEEGNQDESLESEALPAEDQVKDRSTGTQVVAGQIF
LESGKSDSQPEDEENLHSQEEEKENSLEELNSLDMSDLLNKDLEDTEMQSPVLTAIGGTA
DGEPCHFPFLFMEKEYAECTADGREDGRLWCATTYDYKKDQKWGFCETEEQSNKRRQMQE
AEDIYQTGMKILNESTKKAQKKEAYQYLLKAADMNHTKAMEKVSYALLFGDYLKQNIQSS
KELFEKLTEEGSPKGQMALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMILGYRYW
AGIGVLQSCESALTHYRLVANHVASDISLTGGTVVQRIRLADEVENPGMASGMLEEDLIQ
YYQFVAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFEYFNQAANAGNSHAMAFLGKMYSE
GSDVVPQNNETALQYFKKAADMGNPVGQSGLGMAYLYGRGVPVNYELALKYFQKAAEQGW
VDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHATGTGVMRSCHTA
VELFKNVCERGRWSERLMTAYNSYKDGDSNSAVVQYLLLAEQGYEVAQSNAAFILDQKEA
SIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQH
SAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVIYAVQYIR
EMNLREVFSHIDMDQLLGPEWDLYLMTIITLLLGTIIAYRQRQHQAIPRPAGLRPAVPQQ
EPPPPEHQPPQ
Download sequence
Identical sequences E1C6X2
9031.ENSGALP00000017201 XP_421303.2.86415 ENSGALP00000017201 ENSGALP00000017201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]