SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1JHG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1JHG8
Domain Number 1 Region: 18-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.3e-51
Family Hypothetical protein AT3g04780/F7O18 27 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1JHG8
Sequence length 211
Comment (tr|E1JHG8|E1JHG8_DROME) CG6153, isoform C {ECO:0000313|EMBL:ACZ94252.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG6153 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPHGHSHDHGGCSHEASDVDHALEMGIEYSLYTKIDLDNVECLNEETDGQGKSVFKPYEK
RQDLSKYVESDADEELLFNIPFTGNIKLKGIIISGANDDSHPNMVKIFKNRPRMTFDDAR
AKPDQEFQLTRDARGEIEYSPKVVTFSSVHHLSLYFPSNFGEDITRIYYIGLRGEFTEAH
YHGVTICNYESRANAADHKEKAFDGVGRAIQ
Download sequence
Identical sequences E1JHG8 Q9VK68
NP_001162966.2.81976 NP_609580.1.81976 FBpp0079975 FBpp0079975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]